CAZyme Information: MGYG000003214_04119

Basic Information

• Species: NSJ-32 sp014384895
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; UBA1390; NSJ-32; NSJ-32 sp014384895
• CAZyme ID: MGYG000003214_04119
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1032	MGYG000003214_393|CGC1	117893.93	4.9789

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003214	5745180	MAG	United States	North America

• Gene Location: Start: 7198; End: 10296 Strand: -

Full Sequence      

MDRFAQIAKEGVSVQERGLIIPEPEKKDVIFLQNISDARYQFTPLKKMDSEEELSEALLA
ARKEYRPYMRDLAPEMEELRERMPIQRAGWRIQTKADQQDFQGVLDGKGQWEEVQLPHYG
APVGKATTFYRMCFDLTESMASKDAIYLCFKGVDYKAAVYVNYRFVGSHEGFFAPFEFQI
TDFVREKDNVLLVVVENDAVHSDGGEKIYAATGLGFDDSKVGWHHCPPGMGIYQEVYVEG
RSAVSIADIFVQPMENLEDASCWIEVSAASAMKKKVRLELSLYGQNFDETVFTALPYDPS
TNLEVGLGDSLTEAQTKADDVYHKPMPLFVQQGRNRFAVPFHIPGARRWSNSNPWLYQVQ
VRLLDEEGKLLDCRKQQFGMRYFSMDTEGERKGRFVFNGETIRLRGANTMGHEQQCIYKG
DMEQLMDDILLAKICNMNFLRITQRPVQPEFYDYCDRLGLMLQTDFPLFGVLNREKFCEC
VREAEEMERLIRSHACCILVSYINEPFPNANNQPHRCLERKELEEFFTAANIAVHLQNPD
RVIKPIDGDYNPPEETSLPDNHCYPCWYNGHGIDIGRLYKGYWMYVKPGWYYGCGEFGAE
GLDPVSVMRKYYPSEWLPQTEDEEASWSPEKIVGAQTGRFHYFFFKTPTSLAQWVEKSQE
HQRFATQIMTEAFRRDSRMNTFAIHLFIDAFPSGWMKTIMDVERRPKPAYFAYRNALEPV
LVSLRTDRFTYFAQETAHVECYICNDTNEYLTQCWLQYYAVCDGKVLMSGRHPAKIGACT
SQFQGYITVPMPSVSKNGRKTVTVVAGLFDGAGRLLQDASQELTVFGAARDSLLGIPLDW
HKPPLFILGNEGKASALLQDMDLEAQPFPSTSPQEAGVIVVDDYLAYAARKDSIDAWVRG
GGRLVFLELPTGRYQIADDTVEVRPCPMLPVHFAAVEDVPFMEGFEEQDFRFWYDEQAEY
ITPLAEYVVIGENFDRLLGGATAGDRDHWTSAHIAAMKECGKGRIILCELKLPGRVNSNP
AAKRFAAKLLEN

Enzyme Prediction     

No EC number prediction in MGYG000003214_04119.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	89	796	1.1e-77	0.6914893617021277

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	8.30e-35	146	724	82	636	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	6.31e-24	122	505	105	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	2.20e-16	130	460	124	408	beta-galactosidase.
PRK10150	PRK10150	1.30e-13	123	506	64	418	beta-D-glucuronidase; Provisional
pfam02837	Glyco_hydro_2_N	2.81e-08	122	238	61	165	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE97824.1	0.0	2	1030	23	1049
QUI23767.1	0.0	2	1031	7	1033
QDH23079.1	0.0	1	1030	9	1038
QNK56944.1	0.0	2	1030	21	1066
QBE96176.1	0.0	2	1030	8	1046

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	1.05e-23	123	724	77	660	Crystalstructure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
3OB8_A	9.57e-19	107	471	89	425	Structureof the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_B Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_C Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_D Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OBA_A Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_B Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_C Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_D Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis]
6ED1_A	1.94e-18	90	599	33	515	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]
6S6Z_A	2.23e-18	99	460	58	384	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	2.23e-18	99	460	59	385	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P77989	3.05e-21	108	496	29	378	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
B4S2K9	1.99e-19	122	460	116	406	Beta-galactosidase OS=Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype) OX=1774373 GN=lacZ PE=3 SV=1
P06864	3.98e-18	122	473	105	407	Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ebgA PE=1 SV=4
P00723	5.22e-18	107	471	82	418	Beta-galactosidase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=LAC4 PE=1 SV=2
A1SWB8	1.19e-17	122	505	114	460	Beta-galactosidase OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003214_04119.