CAZyme Information: MGYG000003214_04590

Basic Information

• Species: NSJ-32 sp014384895
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; UBA1390; NSJ-32; NSJ-32 sp014384895
• CAZyme ID: MGYG000003214_04590
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
300	MGYG000003214_434|CGC1	34020.34	8.087

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003214	5745180	MAG	United States	North America

• Gene Location: Start: 24062; End: 24964 Strand: -

Full Sequence      

MGVWGKWIKRAKYIYNIQDFNPEQVMAVGYSKNPLILKAMIWLDKFSCKQSDLVITVGRD
LVETMNIRFKGKKVPKTVMINNWIDEKKIYQLDKDNEGVVAFKRKYGLEGKFVIMYSGNI
GLYYGLEDLITVIEKFEPGTKTNDGRDVIFAFVGAGTVLDKLVKYVDRHHMDNVTFIPYQ
DKANLIYSLNAADVHWVVNAKGIKGVSCPSKYYGVASCQKAILAVLEKGSEVHLIIEETQ
NGLVSEPGNCKTIEDNIRWFIENADSDELVAMGQRGRENLEQNLTKDVSLEKYKNAILGL

Enzyme Prediction     

No EC number prediction in MGYG000003214_04590.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03794	GT4_WbuB-like	9.79e-57	2	294	115	391	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
PRK10307	PRK10307	4.83e-32	10	300	131	408	colanic acid biosynthesis glycosyltransferase WcaI.
COG0438	RfaB	3.86e-16	1	300	100	377	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03801	GT4_PimA-like	1.53e-13	1	293	96	361	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
pfam00534	Glycos_transf_1	5.56e-08	110	278	1	157	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL24096.1	1.92e-157	1	300	123	422
QCU03773.1	8.44e-155	1	300	127	426
AKP76099.1	2.12e-132	1	297	128	418
QYF84817.1	1.18e-131	1	297	128	418
QIZ05650.1	2.37e-131	1	299	127	420

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8KIU8	1.32e-25	12	300	121	394	Probable glycosyltransferase WbjE OS=Pseudomonas aeruginosa OX=287 GN=wbjE PE=3 SV=2
P32057	2.05e-12	11	299	131	407	Putative colanic acid biosynthesis glycosyl transferase WcaI OS=Escherichia coli (strain K12) OX=83333 GN=wcaI PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003214_04590.