CAZyme Information: MGYG000003214_04684

Basic Information

• Species: NSJ-32 sp014384895
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; UBA1390; NSJ-32; NSJ-32 sp014384895
• CAZyme ID: MGYG000003214_04684
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
778	MGYG000003214_442|CGC1	90104.44	6.2132

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003214	5745180	MAG	United States	North America

• Gene Location: Start: 1995; End: 4331 Strand: +

Full Sequence      

MIWRAKWIYHPEVDLHKKAALMFRKRVQMDQPPKIARIFVSADSRYKLYVNGSYVGNGPL
KGDPYRQFYETFDISQYLIPGENVIAAYVLRFPPDDRKAVTFETGPVSLVNNSRGGFFLQ
GESEAGFDTDESWKTSLDPAYTFVHSIKSRYAGDMEEVDGRKSLTGWEQRDFKDNRWQRA
ICVGAGDGVTPYGVVSGWQLTKRPLPQLYEKSITPIAWRSPGGQMDFTPLSEGRGVAIAP
HTDCQVILDMGELVTSYVQLQMEGGRHSRVQLLYSECYGYKDPTTGEIRKGDRTDFLHGD
LYGETDVYWKGDGGQWYEPFFFRTFRYLRIAIYTQDQPLFLKQVLFRMTGYPLAIETRFQ
ATQPQIQAMWDVSVRTLERCMHETYEDCPYYEQMQYLMDTLIESEIAGCLSRDDRLTRRA
LLDFHSSQRPDGMVTCNYPASFVQIIPAFSIYYIDLLWRHYDRYGDKGVLEHYLPTVLGI
LQYFRERLCERTGLVQHPGYWEFIDWVDGWTENRGSPTGEGEPYCFIYSQLYAYGLLTAA
HICEALEFPDLASHLKNRHRQLVRAINRQAVDPVTGLYRTKPGDTQFSQHGQLWAVLSEC
VEGERAKDIMLACIRNPKLLSCSYSMTYYLFRAFEKAGVYPYSGPIWQSWRDLLAYHVTT
WPEDPVTQRSECHGWSGLPVIEFIRCSFGVRPGAPGFKSILIAPCEFDLGDMEATICTVQ
GPIYARRRIVLEGMLRRAEFWYEFPRKMPVHVTLPEQDYDTVTEELHLRFDFPMSERL

Enzyme Prediction     

No EC number prediction in MGYG000003214_04684.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	245	726	2.4e-93	0.9365079365079365
CBM67	5	185	4.6e-39	0.9602272727272727

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08531	Bac_rhamnosid_N	1.13e-14	32	180	2	150	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17389	Bac_rhamnosid6H	2.14e-11	359	589	6	229	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam02837	Glyco_hydro_2_N	5.75e-05	34	94	83	138	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
pfam17390	Bac_rhamnosid_C	2.18e-04	689	768	1	63	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
PRK10340	ebgA	0.003	39	91	132	179	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK59208.1	2.69e-210	5	726	5	730
BBH24613.1	3.84e-175	3	764	7	794
QTH43327.1	2.92e-170	3	764	7	790
QNK56541.1	3.44e-162	3	756	8	783
BBI31976.1	2.59e-158	3	756	7	782

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	1.76e-32	3	764	6	951	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
6I60_A	3.16e-25	3	723	145	871	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
4XHC_A	6.48e-20	325	685	173	539	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]
3W5M_A	3.74e-15	36	726	319	970	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
3CIH_A	3.71e-09	323	724	271	673	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	2.04e-14	36	726	319	970	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003214_04684.