CAZyme Information: MGYG000003214_04798

Basic Information

• Species: NSJ-32 sp014384895
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; UBA1390; NSJ-32; NSJ-32 sp014384895
• CAZyme ID: MGYG000003214_04798
• CAZy Family: PL12
• CAZyme Description: Heparin-sulfate lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
672	MGYG000003214_459|CGC1	76686.4	5.1214

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003214	5745180	MAG	United States	North America

• Gene Location: Start: 13626; End: 15644 Strand: +

Full Sequence      

MDRKAGPKLTDAQFFSELVDCTLPGLEEIPAAAARGDFVACRRLFAAHVRQSLQPDRFFA
IPYEFPENQFTVAGESEEEAGERIKKHILISVGVPCQFEGKVDWFANPTYNGFKEWTWQV
NRCPEWKLLAHLYHTTGDESYAETFAQLFDSWVMQAVAPEEDVSGGETLCWRTIECGIRM
GANWPYTLFSFYRSSHFTDDRLVDWYKSVWEHGHRLRVNHTTCNWLIMEMNGLGQIGILY
PQFRAAKEWLEFAVQVLAKELDLQVYPDHFHFELSTDYHYVVINNYMRLVRVAGAFAVPL
PESFVRRIEQMLEVFVKLMRPDGCLPDLNDGCHDPVKTFIDEQIRYFPDNKVFAWVSHGR
KGIGAPAYTSVALEYAGMMVMRSGWGEKDTWGFLDAGPFGTGHQHEDKLNLLIHAKGQYI
LTECGTYAYDGSEMRKYALSTRSHNTVRVDGMDQNRRAHYRWHEGDIAQKARMTYRIEEA
FDYVSATYDEGYGVCDLHSSEAPAHMGASHSRSVFFLKKPGHGMEAFFLVIDRLQSEDEN
EYELLWHVDAGTVSVHGMDVTADFLHLLVSLKDRKRDGVDLICGQQKPEWQGWKPGPTGI
QGDDAPLPTVQYMTHGSNLRVVTVLYPGEDCPITAVEASRDVEDTRVTLVLRDGFQLDYD
ESLGGCRTDGEQ

Enzyme Prediction     

No EC number prediction in MGYG000003214_04798.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL12	376	491	5.9e-24	0.8115942028985508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16889	Hepar_II_III_N	1.03e-65	17	355	2	344	Heparinase II/III N-terminus. This is the N-terminal domain of heparinase II/III proteins. It is a toroid-like domain.
pfam07940	Hepar_II_III	2.36e-23	365	547	1	163	Heparinase II/III-like protein. This family features sequences that are similar to a region of the Flavobacterium heparinum proteins heparinase II and heparinase III. The former is known to degrade heparin and heparin sulphate, whereas the latter predominantly degrades heparin sulphate. Both are secreted into the periplasmic space upon induction with heparin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM68796.1	4.02e-199	14	669	20	667
AHF90891.1	3.12e-81	7	627	32	660
AHF92618.1	1.05e-78	9	660	78	738
AHF90266.1	1.65e-75	13	657	44	689
AHF91117.1	2.45e-70	10	657	429	1087

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MMH_A	6.19e-35	25	548	19	518	Crystalstructure of heparan sulfate lyase HepC from Pedobacter heparinus [Pedobacter heparinus]
4MMI_A	6.19e-35	25	548	19	518	Crystalstructure of heparan sulfate lyase HepC mutant from Pedobacter heparinus [Pedobacter heparinus]
5JMD_A	4.17e-31	6	561	10	551	HeparinaseIII-BT4657 gene product, Methylated Lysines [Bacteroides thetaiotaomicron VPI-5482]
5JMF_A	4.17e-29	6	561	10	551	HeparinaseIII-BT4657 gene product [Bacteroides thetaiotaomicron VPI-5482]
4FNV_A	1.85e-20	99	570	138	603	CrystalStructure of Heparinase III [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59289	3.77e-34	25	548	43	542	Heparin-sulfate lyase OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) OX=485917 GN=hepC PE=1 SV=1
C7EXL6	1.36e-29	4	561	19	562	Heparin-sulfate lyase OS=Bacteroides stercoris OX=46506 GN=hepC PE=1 SV=1
Q89YR9	1.01e-19	99	570	138	603	Heparin-sulfate lyase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=hepC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003214_04798.