CAZyme Information: MGYG000003214_04996

Basic Information

• Species: NSJ-32 sp014384895
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; UBA1390; NSJ-32; NSJ-32 sp014384895
• CAZyme ID: MGYG000003214_04996
• CAZy Family: GH127
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
610		70271.02	5.6471

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003214	5745180	MAG	United States	North America

• Gene Location: Start: 18753; End: 20585 Strand: -

Full Sequence      

MEYIPYSSVEMKDGFWHSKQKLNREVTIFAVLEQFQKTGRFDALQCNWKPGMPNKPHIFW
DSDIAKWVESAAYILQKGPDERLESICEWVIDQIEKNRTSEGYFNSFYLTVEPQGRWQGR
GNHELYCAGHWIEAAVAYYEATGRDRFLHMMEEFARYIQQVFVKEQSASFVTPGHEEIEL
ALYKLYRCTGKTEYRDLSKFFLDNRGVRPREPEAMGIQSHLPVREQKSAKGHAVRAMYLY
SAMADIARDCCDQKMQEACEALFQDIVRHKLYITGGIGSSKHGEAFTIPYDLPNKEAYTE
TCAAIGLIFFSSRLLLSQVDSIYGDVVEQVLYNGFLSGLSLDGKAFFYTNPLELCPEWLE
KDVDKPKEDQPWLPWLTQRVKVFGCSCCPPNVTRLLASLGGYQYTYEGDALWVHQYMDSE
AVHGGMQIRQETQYPNDGRISITVDGVGRLAFRIPGWCSAYKIFLDGQPWEGEEKRGYVY
LRLPPGRHNLELQLDMPCVLVEAHPRVREDAGRVAVRRGPVVYCVESVDNGPMVSEIMLD
GKAFWEAEYEETYGMHILHTKGLRRNPDGFGDCLYREMVEDRLPVKITMVPYYAFANRGV
SEMQVWLLRA

Enzyme Prediction     

No EC number prediction in MGYG000003214_04996.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	9	524	7.9e-172	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3533	COG3533	1.28e-159	9	609	12	587	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam07944	Glyco_hydro_127	8.05e-139	8	524	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS96918.1	1.81e-182	4	608	12	626
ADH61394.1	6.79e-171	1	607	9	645
QHQ63226.1	9.48e-171	4	608	9	623
QDP39470.1	5.91e-165	4	607	6	639
AZN43118.1	1.22e-164	4	607	13	654

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	4.32e-159	58	607	73	645	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	6.22e-153	58	607	73	645	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	5.66e-122	4	607	10	623	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
3WKW_A	1.61e-116	58	610	72	659	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
7EXU_A	4.49e-116	58	610	72	659	ChainA, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	2.57e-115	58	609	72	658	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003214_04996.