CAZyme Information: MGYG000003216_01181

Basic Information

• Species: UBA10677 sp900760475
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-552; UBA10677; UBA10677 sp900760475
• CAZyme ID: MGYG000003216_01181
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
533	MGYG000003216_18|CGC1	58813.12	5.3995

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003216	1972106	MAG	United States	North America

• Gene Location: Start: 18278; End: 19879 Strand: -

Full Sequence      

MNSEKTSADASAVTVEYVFPAAVVAAEKTENAEAIITEKELQINLVEPQLTRIEKGGYLV
LDFGRELAGGVRILAFDAGCRVRLRLGESVSETFSELGGAKPGCNDHAVRDAEVFLPSLC
DQEYFQSGFRFLRIDATEKDVAIKSVVAVYKHVGYNRVGAFSCSDKVVNRIFDTAAHTVT
LCMQNGLLWDGVKRDRLVWIGDMYPEFLAGFGLYKECGYARRCLDYARETTPLPGWMNTM
PTYSLWWILCLKEYVYHTGDIDFLRKNRYYLDELLKIYDGYIADDGEIKTPGIFLDWPSH
DTPDEKYGVRAIAKMAADAADALDVTLFYKSPYTASIKRKLAAVKGAPSEKKQAVALSLL
AGYDADPALLIKDGACGMSTFMSWAILNAAHDYASPEAAAEMCRDYYGAMLKLGATSFWE
DFDMQWLEGAAPVTRLSAAGEKDVHGDYGKYCYKGFRHSLCHGWSAGVINYLQTRILGVR
PVQFGGLSVRVRPYAAYGDMTGVVPVAGGQVKVEVRSGRVSIEASPGIEIISD

Enzyme Prediction     

No EC number prediction in MGYG000003216_01181.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	54	521	2.8e-68	0.9603174603174603

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	4.17e-08	157	304	2	160	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	0.003	55	149	4	99	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP57578.1	4.82e-111	1	531	27	583
QGQ98689.1	9.59e-111	30	532	34	558
QUT48045.1	4.63e-108	16	531	27	582
QBM20341.1	5.06e-108	17	531	28	565
BBH21551.1	6.48e-107	30	532	34	557

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	7.96e-27	37	527	168	688	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	6.99e-22	128	530	504	937	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	1.09e-07	53	465	89	531	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003216_01181.