CAZyme Information: MGYG000003220_00223

Basic Information

• Species: HGM12957 sp900760695
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; QAKW01; HGM12957; HGM12957 sp900760695
• CAZyme ID: MGYG000003220_00223
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
190		21902.4	7.7739

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003220	1846233	MAG	United States	North America

• Gene Location: Start: 15445; End: 16017 Strand: +

Full Sequence      

MIKRRISKSFLLKILIAAVMLVIMAFFAIFSLPKAMYPIPESCRAFVEHYSELYNVDKYM
IYSIIKCESNFRENAVSNAGAVGLMQVTEPTYEWALVRMGEDVKDKISLNDPETNIKFGT
YIYSMLLSEFKDERTALAAYNAGRSKVIEWLKDPRYSDDGITLKDSAYSETDDYVRKVMA
SYKIYSKIYS

Enzyme Prediction     

No EC number prediction in MGYG000003220_00223.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	59	185	5.9e-26	0.7925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	3.08e-60	44	184	5	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	4.17e-40	37	188	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	9.36e-30	60	183	3	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	3.48e-29	12	189	108	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	8.20e-24	54	152	8	104	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACL76418.1	8.15e-40	1	189	1	191
AEY66639.1	9.23e-39	1	189	1	191
CDZ23581.1	1.20e-38	40	189	38	188
CAB1248982.1	1.14e-37	32	189	39	195
AGY75482.1	8.34e-37	10	189	3	180

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	1.28e-14	40	187	446	594	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	1.29e-14	40	187	475	623	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FC4_A	3.20e-14	40	187	447	595	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FCQ_A	3.20e-14	40	187	446	594	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
5MPQ_A	5.65e-12	55	189	428	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31976	5.71e-10	45	182	1424	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	5.71e-10	45	182	1424	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31608	6.74e-10	42	182	59	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
Q9CLB8	7.00e-08	54	170	201	325	Membrane-bound lytic murein transglycosylase C OS=Pasteurella multocida (strain Pm70) OX=272843 GN=mltC PE=3 SV=2
Q7VKB7	3.23e-07	47	149	203	315	Membrane-bound lytic murein transglycosylase C OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) OX=233412 GN=mltC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999231	0.000529	0.000036	0.000002	0.000001	0.000239

TMHMM  Annotations     

start	end
9	31