CAZyme Information: MGYG000003220_00511

Basic Information

• Species: HGM12957 sp900760695
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; QAKW01; HGM12957; HGM12957 sp900760695
• CAZyme ID: MGYG000003220_00511
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401		45484.8	5.8099

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003220	1846233	MAG	United States	North America

• Gene Location: Start: 20056; End: 21261 Strand: -

Full Sequence      

MNIAVIGTGNRGRGLIKNNLVFMDDVNIIGISEIQPQNLDKCLEVIKEAKRPAPFATDDY
NEIFKLSGLDAVIIATGWKLHTPLLLKAMEKGIPAATEVYGAYSEAECWDIVNTYEKTKT
PVMMLENCCYGRDELMLLNMVRSGVLGTVVHCEGGYRHDLRSEVGFAREHGHYRLDDYIE
RNCENYPTHELGPIANILNIGHGNRMVRLTSFSTKALGLKDFYRSRRGDDCEYLNLDIKQ
GDIVTTIIECAGGETITMALDTTLPRYYSRRFGVHGTKGMFTEDNGSLFLDSENYDPKVE
FHWKPMWGNVENYRDKYEHPIWKKYLSEGVKSGHGGIDWLVLRAFIEALEKSKPMPIDVY
DFTSWMSVTYASEQSIKNGSTAVELTDFTNGKWKTRPPVEL

Enzyme Prediction     

No EC number prediction in MGYG000003220_00511.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	2	396	4.2e-135	0.9824561403508771

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	2.70e-17	1	385	4	340	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	3.85e-07	1	124	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
COG4091	COG4091	0.004	3	77	20	110	Predicted homoserine dehydrogenase, contains C-terminal SAF domain [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTH41319.1	5.75e-160	1	393	8	397
QJD87109.1	1.06e-153	1	393	5	394
QNK55026.1	1.41e-151	1	393	5	394
QTH43530.1	4.18e-151	1	396	5	398
ALS29040.1	5.52e-150	1	398	5	400

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	7.88e-95	1	394	21	432	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	2.67e-72	1	399	43	444	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2FLK4	8.05e-103	1	399	34	447	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A4Q8F7	4.32e-94	1	394	21	432	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
A4Q8G1	7.35e-86	1	398	53	464	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
A8H2K3	2.84e-82	1	399	53	451	Glycosyl hydrolase family 109 protein OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) OX=398579 GN=Spea_1465 PE=3 SV=1
A6LB54	4.13e-81	1	398	50	462	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000085	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003220_00511.