CAZyme Information: MGYG000003220_01259

Basic Information

• Species: HGM12957 sp900760695
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; QAKW01; HGM12957; HGM12957 sp900760695
• CAZyme ID: MGYG000003220_01259
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
749		85352.37	7.0466

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003220	1846233	MAG	United States	North America

• Gene Location: Start: 12464; End: 14713 Strand: +

Full Sequence      

MKNKFSGANWIGIRAGERLPLDANLLEYIEKNDVKRYYRPYSLLLRGRFDIEKQVTKAVI
RIAGVGFYHAYINGHRIKDTALGPAATDYRQIVLYDKVDVTGLIQKEGNCIVIELGNGRY
SFNPKYWGWKGCFFGSPRAIAQLIISYQDGSEDIISTGPGWKIKRGAVTSNCIYDGMTLD
LRLQDKDLHNPKMDESGWKNAEVVEAPCKELVPNRMPDIRACGENQAIKRIKTGPLTETF
CFEYNCTGWTAIKVKGSSGARVTVKYAEKINEDFTLDTKSNRGALNTDCFILSSDDEVWL
EPRFTYRGFRYASCEVSDPGVIVLNAVQKHVHSDVKQTGSFTCDNKLINKIHNAYLLTQK
NALLGVPLDCTQRDERLGWLGDAYVTCESCMYNFDMLSFYDKWLRDIRLDCNPQTGDIHH
IAPWPQGGDVDSPDFSIGFLIIALKYYQHYASKSAIKLNFDAFEKYIRHLVDISDDYILP
KSRYGDWKSAVKGFERGDPYYCNTVYLYYCVVLVKQFCNILQNGKENYYDNLAKNIKAKL
IELYYNPSKKQFGDATQFSNALALTAGLIPEQDVDSVFNNLVADITTLNNTHLTTGIFGT
WMVMELLRQFDKKDLAFSLMTQKTYPSWLNMLENNTTLTENWNGSEASLNHCMFGSVDAQ
LYKILGGINLDSLAKQYITISPYFTRECGYVKAKVHTQYGDVLSEWKREDDSIKLTVLLP
EGVKSRIYIPELPFDRILEGGMYTFTFTM

Enzyme Prediction     

No EC number prediction in MGYG000003220_01259.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	242	728	4.2e-124	0.9722222222222222
CBM67	42	207	9.3e-28	0.8806818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.33e-71	336	665	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	2.06e-45	53	220	1	169	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	4.18e-18	231	317	1	85	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	8.69e-11	667	741	1	75	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGY47007.1	1.05e-157	8	739	143	879
AEE96386.1	3.99e-133	8	738	126	851
AEE97752.1	9.56e-132	8	741	124	856
ACI19983.1	1.34e-130	37	738	148	883
AIY87265.1	1.33e-129	35	745	143	855

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	8.46e-132	37	738	171	906	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	1.98e-77	45	737	305	1002	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	6.58e-75	22	740	113	857	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	6.78e-82	46	741	188	918	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KNB2	1.06e-78	8	730	151	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	9.44e-77	45	737	305	1002	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	5.87e-68	45	730	173	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003220_01259.