CAZyme Information: MGYG000003221_00008

Basic Information

• Species: OM05-12 sp900760755
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; OM05-12; OM05-12 sp900760755
• CAZyme ID: MGYG000003221_00008
• CAZy Family: GH20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
772	MGYG000003221_1|CGC1	87619.95	5.6131

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003221	3509168	MAG	United States	North America

• Gene Location: Start: 15427; End: 17745 Strand: +

Full Sequence      

MKQPFIIIFIIIALFTNCSNRYTKDTDVRIVPVTERVTIDKGEFVFSKKTTLAFDNNKFA
GVASQLASLFKKSAGFVPQLSSSLSDADIIFVTDSTLKEEAYRLIIAAGKIQINASGSKG
AFYAVQTLRQLLPAELESPVPVENVLWSVPALTIEDSPRFEYRGLMLDVSRFFMPKERVM
KIIDAASMLKINKFHFHLVDDQGWRLEIKKYPKLTEVGAWRVYREGPFSLKKNPTDPGED
TPVGGYYTQEDIKDIIAFAAERQIEVVPEIEMPAHSNAALAAYPEYACSVIDHYISVLPG
MGGRNSNVVYCAGNDSVYTFLEDVLDEVLELFPSEYIHLGGDEANKEAWLKCPECRMRMK
KEGITDVEYLQGYFMDRMTKYVQGKGRTVIGWDEWTNSKVPEGAVIYGWQGLGTAGYKAA
KEGHNFVMTPSQILYLDYYQGPQWFEPRTYFGNNTMEKIYSYEPVQAEWEPQAVQRLLGI
QASMWTEFIENPDHAEYMIFPRVAAAADIAWAQKGTKDWADFLNRLDNLVKRWDYMGINY
AKSMYNLDHTVKPDNGVLKVALSCARPDVEIRYTLDGTEPIAASEQYSDTLVVTKDILIK
AATFAGKKCKGKVLALNLKWNKATGKGVTGNNNERVFLLTNGVRGTDKHTDFEWCGWYDQ
NVTFTLDLDREESFDKVSLGHVVNYGMGVHYPKSVNLSVSQDNKQFKEIGKVEFTEKEIF
RDGILTDEFTFDNLMAKGRYLKFDIKSPGKTPAFHHRAGQGVWLYFDEIMVY

Enzyme Prediction     

No EC number prediction in MGYG000003221_00008.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	155	513	3e-115	0.973293768545994

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06563	GH20_chitobiase-like	0.0	160	526	1	357	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
pfam00728	Glyco_hydro_20	1.14e-155	160	502	1	334	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
COG3525	Chb	1.38e-115	30	604	136	702	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd06568	GH20_SpHex_like	2.73e-92	160	526	1	329	A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex). SpHex catalyzes the hydrolysis of N-acetyl-beta-hexosaminides. An Asp residue within the active site plays a critical role in substrate-assisted catalysis by orienting the 2-acetamido group and stabilizing the transition state. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself. Proteins belonging to this subgroup lack the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases.
cd06569	GH20_Sm-chitobiase-like	1.35e-75	156	526	1	445	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI61692.1	0.0	8	772	10	774
AHF11967.1	1.36e-313	30	771	31	770
BCI61680.1	1.42e-310	30	771	31	769
QUT71945.1	5.84e-304	13	771	15	775
QKH86987.1	2.05e-303	8	771	4	771

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q63_A	7.34e-143	13	771	15	773	BT0459[Bacteroides thetaiotaomicron],6Q63_B BT0459 [Bacteroides thetaiotaomicron],6Q63_C BT0459 [Bacteroides thetaiotaomicron]
7DUP_A	1.05e-104	27	549	3	529	ChainA, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_A Chain A, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_B Chain B, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron]
7DVB_A	5.69e-104	27	549	3	529	ChainA, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_B Chain B, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_C Chain C, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_D Chain D, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron]
7CBN_A	3.01e-100	31	556	14	516	Crystalstructure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila [Akkermansia muciniphila ATCC BAA-835],7CBO_A Crystal structure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila in complex with GlcNAc [Akkermansia muciniphila ATCC BAA-835]
3RCN_A	3.69e-99	86	540	64	513	CrystalStructure of Beta-N-Acetylhexosaminidase from Arthrobacter aurescens [Paenarthrobacter aurescens TC1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49008	1.32e-123	25	603	32	597	Beta-hexosaminidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=nahA PE=3 SV=2
B2UQG6	2.25e-99	31	556	33	535	Beta-hexosaminidase Amuc_0868 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_0868 PE=1 SV=1
P96155	3.80e-87	84	507	192	601	Beta-hexosaminidase OS=Vibrio furnissii OX=29494 GN=exoI PE=1 SV=1
B2UP57	5.20e-71	84	535	47	475	Beta-hexosaminidase Amuc_2018 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_2018 PE=1 SV=1
Q04786	4.69e-57	88	577	253	809	Beta-hexosaminidase OS=Vibrio vulnificus OX=672 GN=hex PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000040	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003221_00008.