CAZyme Information: MGYG000003221_00467

Basic Information

• Species: OM05-12 sp900760755
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; OM05-12; OM05-12 sp900760755
• CAZyme ID: MGYG000003221_00467
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
939	MGYG000003221_11|CGC1	103128.7	4.7365

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003221	3509168	MAG	United States	North America

• Gene Location: Start: 88775; End: 91594 Strand: +

Full Sequence      

MKKRITLLSMAFGVLTVFAQQAPIRIDFNKSDRHESEVHEPGYISWVIQECVDTTRVING
ITFKLAKGEESGGVGLKSHWYKAGIQTPYFARLVNDGVFINGGDIDGGEIELTLEGLSPG
KHSLLTYHNQVDAPTDKTFAEISISVNGEEKIKNLTPTQRVTNNYDAATAYIEFEAEENK
PVKFVFYPNYDNYEADAINVIINGLALDVPNLAKQAKSPSPENLDIHVDAADGNYTLRWK
SAPDAVTHRVYLGTDSLTVAQADKGSSCYKGEQAKADTTFAAKDLSPRFYYYWRIDEVEA
DGTVTQGEIWKFSPRLLAFPGAEGYGRFARGGRGGKVVYVTNLEDYDPDKGETPIPGSLR
YAVKEEKGPRTIVFGVSGLITLKTRLTLSDSFVTIAGQTAPNKGICLKSAPFGFSGTSDA
VMRFMRIRIGAGQTYDGTGLNGANHCIFDHMSVSWSIDEAFSSRSGQNLTLQKTMLAEAL
NDANHQNYSPGTRHGYAATISGDVGSFHHNLLAHNEGRNWSLGGGLDGDGNFAGRLDIFN
NVVYNWNGRTTDGGAHEVNFVNNYYKPGPTTLIRGKKTCLNLQHDDFPGTQKYYTNGNIV
EGWYEDLSNPQNGCVDGSWPNGNKKYDPFVTEPFFASFATVETAKDAYKSVLSDVGCTLP
LFDDQDTRIVRETLEGTSTYKGSKTGLPGLIDSHEDAGGWEDYPVEHVNLDEFDSDRDGL
PNWWETMLGLNVNSPEGDFSDANADEDEDGYTNLEEYLNYMATPHVAVEKNEVAEMDLAP
YFMGYSKNAPAYTVVSTSENVTAAIESGKLKVTPKAGFEGIVYVDVKVTDNESSTMTRSF
AFKLGEGIAVGMDAQEQRSQVSIYPNPVFDNLYVNVGANVKQDVTVEIVTLYGQKIATET
FTPVVNASYRMDVSHLSAGVYIVKVQTADKQSAIKFIKK

Enzyme Prediction     

No EC number prediction in MGYG000003221_00467.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	377	565	1.2e-57	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR04183	Por_Secre_tail	1.09e-13	863	939	1	72	Por secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber average twenty or more copies of a C-terminal domain, represented by this model, associated with sorting to the outer membrane and covalent modification.
pfam18962	Por_Secre_tail	2.17e-11	863	937	1	71	Secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber have on average twenty or more copies of this C-terminal domain, associated with sorting to the outer membrane and covalent modification. This domain targets proteins to type IX secretion systems and is secreted then cleaved off by a C-terminal signal peptidease. Based on similarity to other families it is likely that this domain adopts an immunoglobulin like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT77858.1	0.0	1	939	1	936
QUT77843.1	0.0	1	939	1	924
ABQ05483.2	3.25e-278	8	934	12	911
BAV06696.1	1.56e-277	14	928	12	900
QLC65391.1	9.36e-277	17	939	24	922

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FI2_A	4.42e-07	323	546	46	251	VexL:A periplasmic depolymerase provides new insight into ABC transporter-dependent secretion of bacterial capsular polysaccharides [Achromobacter denitrificans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5B297	1.48e-42	316	759	20	408	Probable pectate lyase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyC PE=3 SV=1
B8NQQ7	3.33e-40	312	759	16	411	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
Q2UB83	1.70e-38	312	759	16	411	Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyC PE=3 SV=1
A1DPF0	2.90e-36	316	759	21	412	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1
B0XMA2	9.65e-36	316	759	21	412	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000288	0.999002	0.000187	0.000177	0.000170	0.000151

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003221_00467.