CAZyme Information: MGYG000003221_00479

Basic Information

• Species: OM05-12 sp900760755
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; OM05-12; OM05-12 sp900760755
• CAZyme ID: MGYG000003221_00479
• CAZy Family: GH141
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
623	MGYG000003221_11|CGC1	69169.11	5.8471

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003221	3509168	MAG	United States	North America

• Gene Location: Start: 112055; End: 113926 Strand: +

Full Sequence      

MKYRLPTFISIFLVAFTAVAAGEIWVSPSGNDGNAGTKDAPLRTVAQALKQAREWRRLSH
PAIAGGIRILLQEGVYQQDKTLFIRPEDSGTADSPTVIEAVDGARVVVSGGKRLNGWRRV
TEAIPGLPAGAKGKVWVADAPSVGNRLLEFRQLWVNGVKAVRTVQFAPGEMQRMLAFDAD
KEEIWIPTPVAKGLKEARQMEMTVHQRWAIAILRVKDFDVQGERTRVTFHQPESRLEFTH
PWPQPIIDGEKGSSSFCLGNAIQLLDEPGEWFQDYPSGKVYYWSREGEDMPHAEAIAPAL
EKIVAVDGSLERPVSHILFKGIDFQHAGWYRPSLEGHVTLQGGMYLLDAYKLPVPGLPEK
AELENQAWILRPEAALTIRGAEHIDFVNCSFRHLGATGLDYEWAVKDSEVTGCLFTDIGG
TALVLGAFPERGFETHVPYIPVNKAELCSGISITNNLITEVTNEDWGCVGIGAGYVSDVT
IEHNEVSHVNYSGICVGWGWTPLNSGMKNNRIHANYVHHFARQLYDAGGLYTLSNQPGSS
MTENRLEHLTDAPYATNDRAFYIYFDEATDGYRVENNWCTETRFDSNRPGLSNVWINNGP
TVAGEIKSAAGLQPEYRYLKNKQ

Enzyme Prediction     

No EC number prediction in MGYG000003221_00479.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH141	23	581	7.2e-206	0.9924098671726755

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13229	Beta_helix	3.50e-08	375	535	25	155	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	1.57e-06	403	604	6	155	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam05048	NosD	4.07e-04	372	544	40	170	Periplasmic copper-binding protein (NosD). NosD is a periplasmic protein which is thought to insert copper into the exported reductase apoenzyme (NosZ). This region forms a parallel beta helix domain.
pfam07602	DUF1565	0.005	29	76	2	38	Protein of unknown function (DUF1565). These proteins share a region of homology in their N termini, and are found in several phylogenetically diverse bacteria and in the archaeon Methanosarcina acetivorans. Some of these proteins also contain characterized domains such as pfam00395 and pfam03422.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT77842.1	0.0	1	621	1	621
QUT37927.1	1.69e-304	16	615	7	606
QUT70625.1	1.69e-304	16	615	7	606
QJR76527.1	5.67e-303	1	614	1	612
ALJ42576.1	1.60e-302	16	615	7	606

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQP_A	6.60e-202	19	620	22	623	Glycosidehydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_B Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_C Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_D Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_E Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_F Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_G Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_H Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000783	0.998303	0.000243	0.000220	0.000228	0.000215

TMHMM  Annotations     

start	end
5	27