CAZyme Information: MGYG000003221_00489

Basic Information

• Species: OM05-12 sp900760755
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; OM05-12; OM05-12 sp900760755
• CAZyme ID: MGYG000003221_00489
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1280		144317.23	6.9225

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003221	3509168	MAG	United States	North America

• Gene Location: Start: 128285; End: 132127 Strand: +

Full Sequence      

MVTRIIRLCILLISLSVAMELSAAVSVTAIRTEQLNAPLGIDARQPRLSWMLGSSEKNVM
QTAFHVLVASTPEKLADGEGDLWDSGIVQSGTSHLVPYQGKSLKSNMRCYWKVKSYTTAG
ETAWSEPSMWSMGLLSENNWKGQWIGMDKAAEWDSETQWSRLSARYLRKEFETKKPVKQA
TIHIAGLGLYELYINGKRIGDQVLAPAPTDYRKTILYNTFDVTEAISGKNAIGVTLGNGR
FYTMRQNFKPYKIPNFGYPKMRLNLIIEYADGTTEVIASDASWKLTADGPIRSNNEYDGE
EYDARKELGAWSTFGYDDSRWNPAQRVSIPTGTLRAMMMPCMEVVDTVKPLSITQVGNKY
ILDMGQNMAGWIRMKVGKQQPGDTIRLRFAELLKDDGELYVRNLRDARVTDTYICRGDEK
GTEWAPRFVYHGFRYVEVTGMNKPALTDFIGEVVNDDLEPIGSFACSDKTLNRIYRNAYW
GIRSNYKGMPVDCPQRNERQPWLGDHAMGCWGESYIFDNGSFYAKWTRDICDAQREDGCI
PDVAPAYWNYYSDNVTWPAALPLACDMMYTQFGDTRPMAKHYANIKRWLQHIRDEYMTED
YIITKDKYGDWCVPPESLELIHSKDPARKTDGQLIATAYYLKMLQLMHRFASVLGLKADA
QEWEDLEHRMKDAFNERFLIIKEGTSPVPGHVLYPDSIYYGNNTVTANILPLAFGLVPKP
YINEVVKNTVTTIITTNKGHISCGVIGVQWLMRELSRKGYADVAYLLATNKTYPSWGYMV
EQGATTIWELWNGNTANPEMNSGNHVMLLGDLISWCYETLGGISSSRWQTGFKHILMKPA
FGIQGISHADVSYRTPYGLAVSRWKKTLTHLEWEVTVPVNTTAELHLPDGRVEKIGSGSY
HYSVDIPTRDKAIRKDEFLYEEASFPECHGATIAETPEGDLVAAFFGGTKERNPDCCIWV
CRKEKGSDTWTAPQMVADGVFGEDDPLAVLAGVTAETKDHRKACWNPVLFQIPGGDLLLF
YKIGLKVSDWSGWLVRSKDGGKTWSKREALPKGFLGPVKNKPEYIDGRIICPSSTEGANG
WRVHFEISDDKGKTWRMVGPLEAESALPTQLQRKAMEAKDDPEAGEAIKGEGMKPIYAIQ
PSVLKHKDGRLQVLCRTRNGQLAEAWSSDKGDTWSKVRLTSLPNNNSGTDAVTLKDGRHL
LVYNNFRTLPGTPKGPRTPLNVAISDDGADWIPVLTLEDSPVSQYSYPSVIQGKDGKMHV
VYTWRRQRIKYVEIDLKELD

Enzyme Prediction     

No EC number prediction in MGYG000003221_00489.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	358	887	1.3e-164	0.9861111111111112
CBM67	153	329	6.9e-38	0.9375
GH33	921	1262	9e-38	0.9093567251461988

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	4.97e-139	462	820	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam13088	BNR_2	1.28e-103	939	1260	1	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam08531	Bac_rhamnosid_N	5.48e-72	175	346	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
cd15482	Sialidase_non-viral	2.30e-50	918	1275	4	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam05592	Bac_rhamnosid	1.29e-38	358	454	6	101	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT77833.1	0.0	20	1279	19	1267
QUR43127.1	0.0	20	1275	17	1282
QUT23583.1	0.0	20	1275	17	1282
QDH55645.1	0.0	20	1275	17	1282
QRQ56894.1	0.0	20	1275	17	1282

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	5.42e-187	30	888	35	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	2.50e-129	23	906	2	1032	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.65e-112	24	904	1	865	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
5HX0_A	2.55e-06	915	1262	46	383	ChainA, Uncharacterized protein Dfer_1899 [Dyadobacter fermentans DSM 18053],5HX0_B Chain B, Uncharacterized protein Dfer_1899 [Dyadobacter fermentans DSM 18053]
4YW1_A	4.74e-06	997	1231	400	598	ChainA, Neuraminidase C [Streptococcus pneumoniae TIGR4],4YW1_B Chain B, Neuraminidase C [Streptococcus pneumoniae TIGR4],4YW2_A Chain A, Neuraminidase C [Streptococcus pneumoniae TIGR4],4YW2_B Chain B, Neuraminidase C [Streptococcus pneumoniae TIGR4],4YW3_A Chain A, Neuraminidase C [Streptococcus pneumoniae TIGR4],4YW3_B Chain B, Neuraminidase C [Streptococcus pneumoniae TIGR4],4YW4_A Streptococcus pneumoniae sialidase NanC [Streptococcus pneumoniae],4YW4_B Streptococcus pneumoniae sialidase NanC [Streptococcus pneumoniae],4YW5_A Chain A, Neuraminidase C [Streptococcus pneumoniae TIGR4],4YW5_B Chain B, Neuraminidase C [Streptococcus pneumoniae TIGR4],5F9T_A Chain A, Neuraminidase C [Streptococcus pneumoniae TIGR4],5F9T_B Chain B, Neuraminidase C [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	4.41e-137	38	895	43	914	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KNB2	3.31e-134	32	895	41	886	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	1.43e-128	23	904	2	1030	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	1.47e-124	38	911	43	891	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KM26	5.91e-20	344	889	591	1138	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.062471	0.936196	0.000468	0.000305	0.000274	0.000280

TMHMM  Annotations     

start	end
5	27