CAZyme Information: MGYG000003221_01686

Basic Information

• Species: OM05-12 sp900760755
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; OM05-12; OM05-12 sp900760755
• CAZyme ID: MGYG000003221_01686
• CAZy Family: PL10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
174	MGYG000003221_32|CGC4	20429.34	8.6649

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003221	3509168	MAG	United States	North America

• Gene Location: Start: 138873; End: 139397 Strand: +

Full Sequence      

MYESKKAFDKGVDCILRTQVRQKGKLTVWCAQHDRETLAPCKARAYELPSLSGQESDNIV
FLLMSIPNPSKEIIESIEAAVEWFKTSKIEGIKKEYFTNNEGKKDYRMISCKDCPTLWAR
FYDLETNRPFFCDRDGIKKYDISEIGYERRNGYSWYNSAGNKVLKEYEKWKKSL

Enzyme Prediction     

No EC number prediction in MGYG000003221_01686.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL10	4	162	1.1e-69	0.5451388888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09492	Pec_lyase	1.18e-95	5	164	134	289	Pectic acid lyase. Members of this family are isozymes of pectate lyase (EC:4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase.
TIGR02474	pec_lyase	2.61e-89	5	164	136	290	pectate lyase, PelA/Pel-15E family. Members of this family are isozymes of pectate lyase (EC 4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAO77361.1	3.72e-102	3	174	190	361
QMW84711.1	3.72e-102	3	174	190	361
ALJ40365.1	3.72e-102	3	174	190	361
QNL39168.1	1.06e-101	3	172	191	360
QDM09637.1	1.50e-101	3	172	191	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GXM_A	1.38e-36	5	164	168	323	Family10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXM_B Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXN_A Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus]
1GXO_A	1.38e-36	5	164	168	323	MutantD189A of Family 10 polysaccharide lyase from Cellvibrio cellulosa in complex with trigalaturonic acid [Cellvibrio japonicus]
1R76_A	8.49e-32	7	172	246	406	ChainA, pectate lyase [Niveispirillum irakense]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000007	0.000048	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003221_01686.