CAZyme Information: MGYG000003221_01952

Basic Information

• Species: OM05-12 sp900760755
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; OM05-12; OM05-12 sp900760755
• CAZyme ID: MGYG000003221_01952
• CAZy Family: GH20
• CAZyme Description: N,N'-diacetylchitobiase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
837	MGYG000003221_37|CGC1	95028.27	5.2752

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003221	3509168	MAG	United States	North America

• Gene Location: Start: 32378; End: 34891 Strand: +

Full Sequence      

MKKLFFIILLSPILISCGVEKTATPPVSLIWEMGKNGIEPGCFESTLYIKNTGKEVLTGN
WTIYYTQMSVPPPAVKDNAPILIKQICASYNQLIPTEYFQPLAPGETFIFTYHQKGSITR
EMGAPQGAYIVLTDKNGKEQKPQNIPLEVLPFDKEYQYQRPGNNYPYADGVYMYNQNARF
DKKVDLEVTDIFPSVKQVEKKEGVSNFTSDVKLKWEAVFENEARLLKEKLSSDFQCSVSD
IGKTIIELNRLPNDNKENSDEYYEIVIQDNRFVLSASSAHGIFNACQTLLNILGNAPRLP
VALANMQIADYPDTGYRGLMLDVARNFTKKENVLKLIDYLASYKMNVLHLHLTDDEAWRI
EIPGLEELTEVASRRGHTADESNCLYPAYAWGCDASDTTSLANGYYSRNDFIDILKYARE
HHIQIIPEIDVPGHSRAAIKAMNARYKKYIDTDKTKAEEFLLTDFADTSKYVSAQHYTDN
VVNVAMPSVYRFIDKVIGEFDTMYQDAGLELSVLHIGGDEVPRGAWAGSGICRDLMQEKG
MVEIRELKDYFLEQVIPMLSKRNIQPAGWEEVAMKPDGTVNKRFRNNNIVSYCWNTVPEW
KGDEIPYILANAGYSVILCNVTNFYLDMAYCNHQQEKGLNWGGYVDEYNSFDMLPYDIYS
SVKKTLKGEPVDIKTVSKLKVPLKKEAYAQIKGIQGQVWAETIRSFGQVEYYLFPKMFGL
IERAWNMQPAWAFQEDNEAYEAARQKYNARIAFYELPRLAKRGVNFRVAAPGIVVRDGLL
YANTTIPDAIIRYTTDGSEPTESSACWTEPIACDAKQIKAKAFYLGKSSITILLNND

Enzyme Prediction     

No EC number prediction in MGYG000003221_01952.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	315	726	6.4e-95	0.9525222551928784

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06569	GH20_Sm-chitobiase-like	0.0	310	746	1	436	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
cd06563	GH20_chitobiase-like	6.47e-105	315	725	2	342	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
pfam00728	Glyco_hydro_20	5.95e-103	315	725	2	343	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
COG3525	Chb	1.46e-97	51	811	25	689	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd06568	GH20_SpHex_like	1.60e-60	315	730	2	319	A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex). SpHex catalyzes the hydrolysis of N-acetyl-beta-hexosaminides. An Asp residue within the active site plays a critical role in substrate-assisted catalysis by orienting the 2-acetamido group and stabilizing the transition state. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself. Proteins belonging to this subgroup lack the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT73869.1	0.0	1	837	1	837
QUR46113.1	0.0	6	836	8	840
QDH52947.1	0.0	6	836	8	840
QRN00147.1	0.0	6	836	8	840
CBK66887.1	0.0	14	836	7	831

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QBA_A	1.04e-87	263	820	262	844	BACTERIALCHITOBIASE, GLYCOSYL HYDROLASE FAMILY 20 [Serratia marcescens],1QBB_A BACTERIAL CHITOBIASE COMPLEXED WITH CHITOBIOSE (DINAG) [Serratia marcescens]
1C7T_A	1.99e-87	263	820	262	844	ChainA, BETA-N-ACETYLHEXOSAMINIDASE [Serratia marcescens]
1C7S_A	1.01e-86	263	820	262	844	ChainA, BETA-N-ACETYLHEXOSAMINIDASE [Serratia marcescens]
6EZR_A	3.57e-69	234	767	188	638	Crystalstructure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZR_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZS_A Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6EZS_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6K35_A Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi],6K35_B Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi]
6EZT_A	4.38e-68	234	767	185	635	Crystalstructure of GH20 Exo beta-N-Acetylglucosaminidase D437A inactive mutant from Vibrio harveyi [Vibrio harveyi],6EZT_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase D437A inactive mutant from Vibrio harveyi [Vibrio harveyi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q04786	1.35e-93	42	797	40	809	Beta-hexosaminidase OS=Vibrio vulnificus OX=672 GN=hex PE=3 SV=1
P13670	5.09e-91	42	797	64	846	N,N'-diacetylchitobiase OS=Vibrio harveyi OX=669 GN=chb PE=1 SV=1
Q54468	1.28e-86	263	820	289	871	Chitobiase OS=Serratia marcescens OX=615 GN=chb PE=1 SV=1
P49007	2.07e-86	42	726	53	727	Beta-hexosaminidase B OS=Pseudoalteromonas piscicida OX=43662 GN=nag096 PE=3 SV=1
P96155	7.62e-62	185	720	135	600	Beta-hexosaminidase OS=Vibrio furnissii OX=29494 GN=exoI PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000008	0.006454	0.993578	0.000002	0.000003	0.000003

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003221_01952.