CAZyme Information: MGYG000003221_02560

Basic Information

• Species: OM05-12 sp900760755
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; OM05-12; OM05-12 sp900760755
• CAZyme ID: MGYG000003221_02560
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
518	MGYG000003221_50|CGC1	59484.5	9.626

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003221	3509168	MAG	United States	North America

• Gene Location: Start: 29943; End: 31499 Strand: -

Full Sequence      

MMKYVKYLLWFAALVPLMLYRDYTPDNELRYLSIADEALRDGHFFAFFNQGVAYADKPPL
YLWIVMASRWLFGVHSMLWLGLFSIIPGFVILYVMDKWIAGAVSDKYRKAGGWMLFTTVY
FIGSMLVLRMDMLMAMFIVLALRVFYRMYVGEGKKGDRWLFPLYVFLALFTKGPYGVMIP
FAGVLAFLLIKKQWREAGRYFGWRTWLVLGGLSALWFGAVYMDGGKEYLNNLLFNQTVNR
AVDSFSHKKPVYYYLQTFGYAFAPWCLLYIGVFIAGIRLKLLKTDLEKFFFTVFSVTFVM
LSLISSKLDIYLLPGYPFLAYYVVLQMDRLEKKVWIRWLVAIPAAILFSTLIVVPLLQAQ
VPELSVVNSFWGGAALVFLGAGGLLALVNLCRKKDLTRSIYAIATGMLLAVFSTGFAIDD
LNSEIGYGNLAKKGEELAKESGIATYTSYKVPRAVGMEIYLNRDVEEVEWDSLQQSLARK
EHTILFLRNRVIKREAPLQELIEGKERYEVGQYSVVVW

Enzyme Prediction     

No EC number prediction in MGYG000003221_02560.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	8	466	7.8e-68	0.8592592592592593

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.47e-18	8	409	15	421	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	1.04e-04	1	280	1	287	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam02366	PMT	0.002	47	221	52	237	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKH86812.1	8.99e-138	3	517	4	516
QRO50573.1	1.09e-137	2	516	1	510
QLK84536.1	3.60e-137	3	517	4	516
QTO25703.1	5.09e-137	3	517	4	516
QRP88934.1	1.63e-135	3	517	4	516

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	1.08e-07	5	424	40	458	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	6.05e-15	27	320	29	314	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
B5XTL1	1.89e-07	14	314	19	319	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Klebsiella pneumoniae (strain 342) OX=507522 GN=arnT PE=3 SV=1
A6TF96	3.30e-07	14	314	19	319	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) OX=272620 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.971434	0.027796	0.000415	0.000121	0.000083	0.000164

TMHMM  Annotations     

start	end
7	24
44	66
73	95
110	128
133	150
165	187
200	222
255	277
289	306
310	327
334	356
366	388
400	418