CAZyme Information: MGYG000003223_00671

Basic Information

• Species: CAG-485 sp900760885
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900760885
• CAZyme ID: MGYG000003223_00671
• CAZy Family: GH85
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1250	MGYG000003223_107|CGC1	137646.04	4.8006

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003223	2096251	MAG	United States	North America

• Gene Location: Start: 10817; End: 14569 Strand: +

Full Sequence      

MLLTLPLTAAPQSLRTDYVDWGKKGTDFPSAFASWQKGEKWTTDDNFFISRVKPHLRFRN
PATQVNPDLTEENDKNLLFWVPINKLESNALPDGVFDSEVFPMWAYITHYGNWTAPFVRV
PGNFLDVAHKNGVGVSCLASVPYGQLSQSWGDALEALVQAGPEKMAEFLSWYGVDGIGYN
SEFSSSKTLVSDLSDFHARLIKLMKADDRMPLAMNVWYDGTNEYGSITFDYGLGDHNDDI
WGYGDNIKTSLFFNYNWNSRGILPSTVTHANFLGRSPLDIYAGINMQGREPKTGSRWSML
AKYPVSIGLWGAHSQNMFFESRAEKGPAPEDRQRSYMQRVERWFTGGKRNPILCGEPDNS
LIFGADNSDFAGMSTMMSARSALKWNLSDEPFISHFNLGNGRFFNFRGERQNTLEWYNIG
IQDYMPTWMWWFSTKFLGRDKSDAPAGNLDAEFTWDDAWLGGSCLRVSGSSSSTAYLHLF
KTEFGLRNGDVVTVRYKINSGSGNAGLALSMKGSESTAVEGEALYLTTGREIPGVWNERR
FTVGSEIAADGKELAMIALRFENASKLDMLIGEVSVVRGESTSALPATPKIERTEILASN
RHGADAKIIWEMPNSVTGRVCYNTDVNTSYYKLYARQEGQQPVMMGMTPSWAGLMFSIPV
DYSVSSPKISLGVSALSLDMTKESEIAWSEPMEVSQLYETDDEIILSRDVIIPGEAFEAY
YTDPLHQSADWELLDATGATVAKASESRSLKVSDGLEKPGVYTLRVKGFENPAGEGAKPV
ATTREFPGFVQISDASHGNIPEIKTLTANGNAETAQAKGNEIVTLEYTGEGIDGNVSRGV
RVGQHGVGFNLADASYQRRSPFSIGFWFKPETFADHAAHLLNLRYKGAPWAVNNWGWIWT
TIGPDGRFDEFTVRSDNGSNVSYKFDNTKFEPGAWYHLVFSFDFNNKGSVLASLFVNGKK
REVTSWSVGETQYSASELTYAGKLYNYPAETTAAVGGFLHNSGSVIGNIDNFSYWTKALD
EEGARIAMGDVDPANLPEGLEGWFDFEGNPDAEGRFDNLGSSDFRLGTLDYIPTEIEGQG
TLKWEQPTFCAGSPYVKGEAQEIKGTPVWSVAPAILISSEGDVNSGSAKVKMPGKTTEVD
VKLSLGNAYGTDTRNIRIGVDASSVGEILSVPSGVKVAPNPFSSYFKVEVPAEGEWTAEL
YDMSGVRTGLWKIGADDSRILTAAPAVAPGTYMLKVGNGKAASTFKMIKR

Enzyme Prediction     

No EC number prediction in MGYG000003223_00671.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH85	95	404	1.1e-50	0.946031746031746

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4724	COG4724	1.51e-33	96	563	99	533	Endo-beta-N-acetylglucosaminidase D [Carbohydrate transport and metabolism].
cd06547	GH85_ENGase	2.27e-27	95	431	21	334	Endo-beta-N-acetylglucosaminidase (ENGase) hydrolyzes the N-N'-diacetylchitobiosyl core of N-glycosylproteins. The beta-1,4-glycosyl bond located between two N-acetylglucosamine residues is hydrolyzed such that N-acetylglucosamine 1 remains with the protein and N-acetylglucosamine 2 forms the reducing end of the released glycan. ENGase is a key enzyme in the processing of free oligosaccharides in the cytosol of eukaryotes. Oligosaccharides formed in the lumen of the endoplasmic reticulum are transported into the cytosol where they are catabolized by cytosolic ENGases and other enzymes, possibly to maximize the reutilization of the component sugars. ENGases have an eight-stranded alpha/beta barrel topology and are classified as a family 85 glycosyl hydrolase (GH85) domain. The GH85 ENGases are sequence-similar to the family 18 glycosyl hydrolases, also known as GH18 chitinases. An ENGase-like protein is also found in bacteria and is included in this alignment model.
pfam03644	Glyco_hydro_85	6.09e-20	96	401	5	291	Glycosyl hydrolase family 85. Family of endo-beta-N-acetylglucosaminidases. These enzymes work on a broad spectrum of substrates.
TIGR04183	Por_Secre_tail	1.76e-07	1177	1250	1	72	Por secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber average twenty or more copies of a C-terminal domain, represented by this model, associated with sorting to the outer membrane and covalent modification.
pfam13385	Laminin_G_3	4.34e-05	860	1022	17	148	Concanavalin A-like lectin/glucanases superfamily. This domain belongs to the Concanavalin A-like lectin/glucanases superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ13703.1	0.0	5	1250	14	1247
QUB57152.1	0.0	5	1248	14	1242
QUB59112.1	0.0	5	1248	14	1242
QUB66787.1	0.0	5	1248	14	1244
QUB64520.1	0.0	5	1248	14	1244

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VTF_A	1.14e-33	28	616	17	562	X-raycrystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae],2VTF_B X-ray crystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae]
3FHA_A	1.45e-32	28	616	12	557	ChainA, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_C Chain C, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]
3FHQ_A	1.93e-32	28	616	12	557	ChainA, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_F Chain F, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.855673	0.143049	0.000554	0.000295	0.000156	0.000288

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003223_00671.