CAZyme Information: MGYG000003226_00212

Basic Information

• Species: QALS01 sp900552625
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; QALS01; QALS01 sp900552625
• CAZyme ID: MGYG000003226_00212
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
405	MGYG000003226_11|CGC1	45309.49	5.3481

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003226	3084338	MAG	United States	North America

• Gene Location: Start: 59590; End: 60807 Strand: +

Full Sequence      

MKLLRLALIGAGNRCTALYKADLKKRSDVEIVAVCDTCSEKSEKLASLIEADGRVRPSAY
EDYRRCLGEEKPDAVLISTAWEAHLKIAMYAMESGIAAACEVGGAYSLESLWELVRCYER
TGTPIMLLENCCYGRLELLALNMKRSGVLGRLVHCEGGYRHDLREEISGGAKNGHYRLWE
YICRNCENYPTHEIGPIAKLLDINCGNRFLTLTSMGSLSAGMEKYARDKEIEALAGVRFN
QSDVVTTLIKCQNGETITITLDTCNPRYYSRGFLAQGTKGLIAEENSSVYLEEDNPGECY
DWSAHYNNVGRYYEKYEHPLWQDYHPGSEGHGGMDTLMLDGFFGALSEKKPMPIDVYDMA
TWMSISVLSEQSIATGQSVAFPDFTDGKWIVRKNTFATDSPQVKK

Enzyme Prediction     

No EC number prediction in MGYG000003226_00212.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	2	390	7.8e-133	0.9849624060150376

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	4.77e-19	1	380	1	339	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	7.65e-08	4	122	1	113	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
COG1712	COG1712	0.007	4	122	1	111	Predicted dinucleotide-utilizing enzyme [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTH43530.1	1.29e-148	4	393	5	399
QTH41319.1	1.29e-147	5	396	9	404
QJD87109.1	2.70e-145	5	393	6	398
QNK55026.1	2.91e-142	5	393	6	398
AVM42018.1	7.67e-139	1	395	1	402

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	1.10e-86	2	397	19	439	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	1.39e-69	4	389	43	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
3E18_A	1.11e-09	1	282	3	250	CRYSTALSTRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua],3E18_B CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2FLK4	2.94e-92	5	399	35	451	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A4Q8G1	2.98e-86	3	397	52	467	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
A4Q8F7	6.00e-86	2	397	19	439	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
A6LB54	6.89e-84	4	397	50	465	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
A0KV43	4.45e-76	1	389	52	448	Glycosyl hydrolase family 109 protein 1 OS=Shewanella sp. (strain ANA-3) OX=94122 GN=Shewana3_1428 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003226_00212.