CAZyme Information: MGYG000003226_00364

Basic Information

• Species: QALS01 sp900552625
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; QALS01; QALS01 sp900552625
• CAZyme ID: MGYG000003226_00364
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
576		64213.18	5.7504

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003226	3084338	MAG	United States	North America

• Gene Location: Start: 30995; End: 32725 Strand: +

Full Sequence      

MKTHVCGREYLCEDFGQNFRWTLTGEEKEGVTTLSLTLDFKGKLRPKKTALSFSLPALGA
DGCWSACGGVNRVLTPDWGPFTVNSRSVAGMPVLSILSEDDVNVLTASLSDAETPCALKA
GYREEDSLLAVTLEWFLDVTESMTGYRAQIVIDERRLPFYECVKEASGRLRKKYGAVNAP
PAAHAPAFSTWYCFHQNLEYERILKECRAARDLGLETVIIDDGWHTTDNSRGFGYCGDYR
PQKEKVGDIRLLTKEIHSLGLKAMLWYSVAFSGDFSAQSERFRPLSLYHDGAQNACVLDP
RFPQVREHIWKYCEEAIGDWDFDGLKLDFIDSFRLTQETAERAGINCESLEEGIRRLTEG
LKEKLVRIKPDVLIEFRQAYIGPSMQSLGNMLRVGDCPGSSLQNRVGTIDLRLIAGGAAV
HSDPLEWNEKETPENIARAFINVIFSTVQFSVYPSKLTEAQRAVCERYIRFIKEYRSVLQ
AGEFYPCGVLHNYLAATAAGENKEVTAIFSDTCVRVKNKEAVLLNAGGRYAVIAELPSLY
RYRIEDCMGKSLFFGTASGLASLPVPVGGIAFLTAV

Enzyme Prediction     

No EC number prediction in MGYG000003226_00364.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	179	507	3.1e-27	0.49273255813953487

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	6.64e-47	188	474	6	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
COG3345	GalA	4.28e-12	42	485	134	595	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd14792	GH27	1.22e-06	188	330	5	125	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd06592	GH31_NET37	2.61e-05	188	329	5	151	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
pfam02638	GHL10	0.001	255	393	78	217	Glycosyl hydrolase-like 10. This is family of bacterial glycosyl-hydrolase-like proteins falling into the family GHL10 as described above,.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ22829.1	8.78e-114	28	576	17	576
QTH41069.1	1.90e-113	4	575	6	590
AIQ18885.1	8.27e-112	9	576	10	592
ASA19679.1	2.38e-111	26	570	32	588
AVM46708.1	1.44e-110	30	570	31	582

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000015	0.000015	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003226_00364.