CAZyme Information: MGYG000003236_00871

Basic Information

• Species: UMGS1397 sp900761355
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1397; UMGS1397 sp900761355
• CAZyme ID: MGYG000003236_00871
• CAZy Family: GT2
• CAZyme Description: Beta-monoglucosyldiacylglycerol synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
437	MGYG000003236_39|CGC2	47285.94	8.7603

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003236	2919488	MAG	United States	North America

• Gene Location: Start: 97365; End: 98678 Strand: -

Full Sequence      

MEIMEILATVFWGISFALTALSAPVLLWQGAVGVWGLLPDRKKVQAAAKEPGFGQPLRFA
AVVCARNEEAVIGALLDSLRAQDYPEGLLDLYVAADNCTDATAAVAARHGARVYERFNRE
QVGKGYALRWLLEKIAADRPGLYDAVAVFDADNRVTPGFLRQMDQALRAGADVAKGSRYA
ANPTESWVSGGYAVYWRSMMHFFHRARANCGLSCFVDGTGFAFKTELIRGEGWNTHSLVE
DCEFSMQQICRGKTIVPVSGAVYYDEQPTSFAVSLRQRFRWTVGCVQCVKYCLPDAVRAL
RRGRAGGGPSRLAALDVILYLLLIPAVAASLLSGFFSLLGFLFSPPSAIAADAAFLSLPV
LSWLGLTAGALLTLLRDRQPLRPMRTAVLLFPVFVLSMSAMALIAVLHPKTAWKPIAHRG
QGGAAEAACPSSLPPAL

Enzyme Prediction     

No EC number prediction in MGYG000003236_00871.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	58	284	4e-27	0.9869565217391304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	1.07e-75	62	244	2	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
COG1215	BcsA	2.04e-39	3	420	3	426	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	5.01e-34	62	241	2	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06439	CESA_like_1	8.43e-22	34	288	8	251	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.
pfam13641	Glyco_tranf_2_3	9.50e-21	56	281	1	227	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYH39433.1	1.17e-106	14	421	11	405
BCI60981.1	2.32e-104	14	423	11	409
AYH39439.1	5.33e-96	14	421	11	403
QWT55360.1	2.56e-93	13	418	9	404
CDZ24461.1	2.88e-77	27	418	23	400

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P74165	4.23e-09	62	287	113	338	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
Q8YMK0	1.23e-07	62	287	111	336	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1
Q3MB01	5.03e-07	62	287	111	336	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999995	0.000036	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
10	32
321	343
353	375
387	409