CAZyme Information: MGYG000003237_00049

Basic Information

• Species: Victivallis sp002998355
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp002998355
• CAZyme ID: MGYG000003237_00049
• CAZy Family: GH167
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1360		149598.95	7.1162

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003237	4618450	MAG	United States	North America

• Gene Location: Start: 410; End: 4492 Strand: -

Full Sequence      

MRQRKRILLAGCAAAAALTASADSNLVRNGSFERAGGDSVPLEWNFSRNGDVPVTAFSTT
PGAEGEKCLRIVNRQTGKKPNRFGLLSQTVSLRPDTDYLFSYKIRGPKETNANWAFGSKW
LIRRPVAGASGGGWTQHQFVLRVPADRMEGENLCGVRLITEGPAEFDIDDVRLVPMGDNL
LLNGSFDGIPGQLPPGWSYRISGGADVTGAVDAASALTGKTSFKFVNTTPKNANVYGVLT
QIVRLQPEIDYVLKVHARGEGQGITLAVGSKWAHRLGLQPLTDKWRTYEMPFRLAKDEVG
KDGSTPVVIISEDVAPGVWIDDISVVPKTAPNLGSALWQKNRVYAVDRLPGKFDELKTVP
AGLPVFRLPLSSENAADGKMPDAKNFSADVALGYDDAGLILLARVNDDVSLPGAGSDMWQ
RDSIQIRIDRAAAFAAMSSDTDFEAGFSVGRDGAVQSWCWDGGAQAGKPLPAELAETRVF
RTEQGYFLAARLRWELLGDVKKSGKFGFTIVINDSDSATHRTAYFLTPGLHDKKYATQYI
QALLDTGSPGVLAKLPSTPSAQILEGRLLLSRAPENAVLTAELSDAAGKKFLRSIADIRG
VKPGELVLAPFSLTLDGLAKGNYTVDFKLNGKSVGTAQAVKADLYEQQNELLTELCARLE
RLKKEFASVYGDRPYAVCVSVPIAVLDRHLPLLRKRLKNASGDGEKLFYAEQAAMTARET
ADMLDLLEENLNTLRGGGRLPAAWKYQSGTITLENGWPVADAVCEDGRRERRPVIFTGFG
HFGDIDRDMTVFPGMGVNVVQIELGPSRLFPREGKNREFEPDYSIVNSRILPMLEKAWKN
NNTIALLISPHYHPDWLLKKYPELAAPSGFLKYEVNQPKAREMVREYIAALFGKLKESPY
FGAIHSICLTNEPVYTACRPDNPFSRQEFKKYMEKKYGSVAEFNKVAGTGFADCGAMLDA
VTGNDPAAKYEFYTFAREAFADWHRLLAEEVKKAVPGMPVHTKIMVFSSPFEYASGVDPE
LMGDFSEYNGNDNYFYRRGRWIADWDVTAMTHEIQMSAKPMSIANTENHIIPDGETRPVS
NDHIYTANFQQFITGASTLATWVWADYQYDFAKQNPSHSFIGNIFLRPGNIAAHCLSGLD
GLRLAPEIRKFTDDRPEVALLYSPTATILNSGSYRAETDALYTALCFTGYRPRFLTERQL
ARGEFGNSRLLYVAGAKNVSRAARLGMKKFTENGGRIALTPGSLAQDEFGRPAAPDFPTE
PAAPENAAALTAQIHRSGVAPLPAAVKVAHEDGNSGIFFRMVPDGKGAWLVNLVNYNFEP
RRIQLEGAGKWFDLIREADFQPEFELAPLKPQLLRFTPAE

Enzyme Prediction     

No EC number prediction in MGYG000003237_00049.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH167	709	1355	9e-138	0.9093444909344491

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	1.07e-18	384	544	26	188	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd09619	CBM9_like_4	2.51e-13	368	516	18	161	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
COG1874	GanA	2.21e-11	784	1059	31	303	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam02449	Glyco_hydro_42	3.77e-10	785	1059	12	288	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
pfam06452	CBM9_1	7.68e-10	351	522	3	157	Carbohydrate family 9 binding domain-like. CBM9_1 is a C-terminal domain on bacterial xylanase proteins, and it is tandemly repeated in a number of family-members. The CBM9 module binds to amorphous and crystalline cellulose and a range of soluble di- and monosaccharides as well as to cello- and xylo- oligomers of different degrees of polymerization. Comparison of the glucose and cellobiose complexes during crystallisation reveals surprising differences in binding of these two substrates by CBM9-2. Cellobiose was found to bind in a distinct orientation from glucose, while still maintaining optimal stacking and electrostatic interactions with the reducing end sugar.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM43323.1	0.0	1	1360	1	1360
AVM46829.1	8.46e-236	173	1359	16	1183
AVM43886.1	5.83e-135	551	1354	196	996
AHF94331.1	1.86e-95	13	1355	16	1387
QHW30800.1	4.13e-89	361	1252	498	1367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TTS_A	7.62e-07	785	1059	25	298	ChainA, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_B Chain B, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_C Chain C, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_D Chain D, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_E Chain E, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_F Chain F, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_A Chain A, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_B Chain B, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_C Chain C, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_D Chain D, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_E Chain E, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_F Chain F, Beta-galactosidase [Niallia circulans subsp. alkalophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001172	0.996603	0.000357	0.001296	0.000315	0.000236

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003237_00049.