CAZyme Information: MGYG000003237_00142

Basic Information

• Species: Victivallis sp002998355
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp002998355
• CAZyme ID: MGYG000003237_00142
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387	MGYG000003237_6|CGC3	42833.27	5.3609

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003237	4618450	MAG	United States	North America

• Gene Location: Start: 61874; End: 63037 Strand: +

Full Sequence      

MDDADRLNSPLLPPRFQPGAPDEPFRFQGIPGIEATRGGNRFAVWYGGGDGEGPQNFLML
ARRNPKNPDEWPIVLRVVHPGREIRCFDAALWLDPAGKLRLFWSQSRCRETGKDVSDGVN
GVWQSVCAEPDAPVPNWTRPERLCDGIMLNKPCIASDGSWLLPVSVWGDGIGGGKLPESL
RDVSGANLFVSTDGGQSFRRRGLARVEEGRLFDEHLFVERRDGSLLMLIRTLYGIAESRS
TDGGQSWTPPQRSRLRGPGSRFALRRLKSGSLLLINHQCGVPFSPVREKLTAYLSDDDGE
SWTAGMMIDPRTGVSYPDFTEESNGAILCVYDRDRYGDGEILLAEFTPDDVRKGVLPRPP
QTISALRNRTGDNTEIPTTGEQIKELA

Enzyme Prediction     

No EC number prediction in MGYG000003237_00142.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	23	336	3.5e-23	0.9181286549707602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	1.89e-37	16	347	4	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	1.32e-25	39	327	1	278	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam15902	Sortilin-Vps10	4.46e-04	187	334	2	139	Sortilin, neurotensin receptor 3,. Sortilin, also known in mammals as neurotensin receptor-3, is the archetypical member of a Vps10-domain (Vps10-D) that binds neurotrophic factors and neuropeptides. This domain constitutes the entire luminal part of Sortilin and is activated in the trans-Golgi network by enzymatic propeptide cleavage. The structure of the domain has been determined as a ten-bladed propeller, with up to 9 BNR or beta-hairpin turns in it. The mature receptor binds various ligands, including its own propeptide (Sort-pro), neurotensin, the pro-forms of nerve growth factor-beta (NGF)6 and brain-derived neurotrophic factor (BDNF)7, lipoprotein lipase (LpL), apo lipoprotein AV14 and the receptor-associated protein (RAP)1.
cd02762	MopB_1	0.003	2	51	50	103	The MopB_1 CD includes a group of related uncharacterized bacterial molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site. These members belong to the molybdopterin_binding (MopB) superfamily of proteins.
pfam13088	BNR_2	0.007	239	371	86	221	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM45705.1	5.82e-296	1	387	1	387
AVM47054.1	6.71e-98	26	359	26	365
AMV40667.1	6.86e-95	27	354	51	369
QDU03573.1	1.96e-87	22	354	51	374
QDT85478.1	2.77e-87	22	354	51	374

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003237_00142.