CAZyme Information: MGYG000003237_00678

Basic Information

• Species: Victivallis sp002998355
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp002998355
• CAZyme ID: MGYG000003237_00678
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
806	MGYG000003237_23|CGC2	89559.24	7.7242

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003237	4618450	MAG	United States	North America

• Gene Location: Start: 21126; End: 23546 Strand: +

Full Sequence      

MMKKLILVSALLGSMLIAGAAELIHLKMDFSRPGWNEILSPQGGETTVRDGELSLSAGSS
VVTPYFPLTPGELEVRGIAAGNLTLRIHFLRGGNHRDPGTEVGIRSVQTEKDGNFLFRIP
VADSPAGSDGFRLEISGAPGKKARLRALEIKLAAGDGITINGDPFFQNELGRDHWLVESG
KSRILSDTGHFRGKLLEMTDAGTIVSPRFAYRGEQLTIGLWGMQENLRKGAGQPEWAYAC
VQILLFDRKGKEISHIDLTPIQAGALPWKYYCRTFEPDSWPRNTESFAIASRIFPGATGT
VRLGAVSVIRRGEAAVRPPYRAEGGKIRIGTGKPGEVFSPIWQCADMSFAGDAAQKPMRH
ALRELRRIGVRHLRLREFMQGQRLVKSIAPDGSFELDYSLLDKTFDYVVRELGYQLTVTV
ETTPNQLSVMPGPDDYVYAHPYPPRDLKIWRNILQAVVGHWIDRYGKACVAEWTFECWNE
PNASYFFKGTEAEFAEIFGAYLDALTEIERKHDIRLQIGTMSAAGVTPWFFSCLEKARAI
GKLDAIDALSLHLYAGFIGSMGTFAGDVGRMRRIASEYPPMENRPIYITEYNASTMSDSR
LDTVTNAAFFVKANRIFLDEKVARAYFFAVCDHLWTGNNHHFEGGLGLFTKTAIPKPVLN
ALTLLNRFEGCRRLPVNSSNDPFDAIAGVDETGTVRVLLTTFDERRPEETAAARLRLELD
WTGRSRNIAPRLIRVDSRHANSHAAYREAGSPTITAHPDVTPFRQAGEMKSEPVTKFRFS
GDKLLIDLEPELNSVTCVEIAPAERL

Enzyme Prediction     

No EC number prediction in MGYG000003237_00678.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	347	753	3.1e-48	0.9582366589327146

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01229	Glyco_hydro_39	5.60e-34	326	800	2	487	Glycosyl hydrolases family 39.
COG3664	XynB	2.65e-10	356	802	11	426	Beta-xylosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM45825.1	0.0	1	806	1	806
AVM44872.1	5.09e-145	2	800	107	923
QYG02662.1	1.87e-24	327	804	45	522
QPC95394.1	5.30e-24	368	788	48	463
BCS82259.1	5.57e-24	326	800	2	479

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YYH_A	2.03e-20	327	801	26	503	Crystalstructure of beta-D-xylosidase from Dictyoglomus thermophilum in ligand-free form [Dictyoglomus thermophilum H-6-12],6YYH_B Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum in ligand-free form [Dictyoglomus thermophilum H-6-12],6YYI_A Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum bound to beta-D-xylopyranose [Dictyoglomus thermophilum H-6-12],6YYI_B Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum bound to beta-D-xylopyranose [Dictyoglomus thermophilum H-6-12]
1W91_A	2.17e-17	336	666	12	356	crystalstructure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_B crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_C crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_D crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_E crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_F crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_G crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_H crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct]
2BS9_A	2.17e-17	336	666	12	356	Nativecrystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_B Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_C Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_D Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_E Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_F Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_G Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_H Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
6UQJ_A	9.10e-17	339	805	25	508	Crystalstructure of the GH39 enzyme from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2BFG_A	1.18e-16	336	666	12	356	crystalstructure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_B crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_C crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_D crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_E crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_F crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_G crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_H crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23552	2.11e-24	326	800	8	485	Beta-xylosidase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynB PE=3 SV=1
Q9ZFM2	2.10e-16	336	666	12	358	Beta-xylosidase OS=Geobacillus stearothermophilus OX=1422 GN=xynB PE=1 SV=1
O30360	3.29e-14	397	666	78	355	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=xynB PE=3 SV=1
P36906	8.90e-12	397	774	78	457	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001211	0.997591	0.000480	0.000218	0.000230	0.000222

TMHMM  Annotations     

start	end
5	24