CAZyme Information: MGYG000003237_01636

Basic Information

• Species: Victivallis sp002998355
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp002998355
• CAZyme ID: MGYG000003237_01636
• CAZy Family: GH42
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
797		89286.46	7.4024

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003237	4618450	MAG	United States	North America

• Gene Location: Start: 36833; End: 39226 Strand: -

Full Sequence      

MKYVLLPVLCLFVNLLPAATLEMTGESFAPMIYAHRNGRGRVLEMSDSSEILSRERRSAG
FALLASDREGDREVGLTLKLVWPDGSESAVGEFPPLRLRKDRMLVRQFRLTLDDADLEKL
ASCDGTYNLLLLRLEAEFAGPDGKPLPALNGTAAVGFDRGMRPGFPKAEVVRRNGVPTLS
VNGVFHPGIFGYVGWNWLTARQSIRDFGKAGFHLYEIVFQPWSLWKNGKLDVGELERKLN
SQIVSVAAQDPEAMFFLRYWLYVPRDWSKFHPGEVIRYDDGSSEIPLLGGPWAHASYASV
LWREEYKRMLRELIARLEKGPYADRVFMVRAGYGNCGEWNGFGYHQNKFPDYSPQMQAAY
RMWLKRRYGTLDELNRSWKSSFADWSLIDIPSRAERLGGEGTLLRTSSGSGNCGDYYRFF
SDYTVELIGDFGRTVKEASGGKLLFGVFYGYFLHHLTGVPYHSLDSGHYAMGKLLRLPEV
DTVCSPYNYHRRERAISIGMPLESIKHHGKLFLAEMDLPTHLADAEKYHGTAGESFSCDR
GEADTMTLYRRDFGRVLTWGAGGYWYDFAHGWYEFDAFRKFITDAARTGRAAVNGDMRSI
AEVAVILDEESVFSISLHSGEWAKQLRETLGCTLESAGAPVDFWLASDLGAAVKRGYRLL
VFANRFRADPETDRILAGFRGTLLLLGPEEALPEHACPPGRCLHAPAGLSAGAVRGVLDK
AGVHRYGGAENFFVYANASYLGIWQPEGSREACVVTLPAPARLTDAGSGEAVSLNGRSFR
LPPSERPRFRLYRVENQ

Enzyme Prediction     

No EC number prediction in MGYG000003237_01636.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH42	202	440	4.8e-16	0.5795148247978437

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02449	Glyco_hydro_42	9.15e-14	264	428	73	217	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
COG1874	GanA	6.87e-10	172	444	9	254	Beta-galactosidase GanA [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44099.1	0.0	1	797	1	797
SDT33465.1	2.29e-53	167	680	51	570
ASV74990.1	1.10e-36	235	649	267	659
AQX14574.1	1.46e-08	178	441	5	242
VEP38607.1	1.46e-08	178	441	5	242

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Y2K_A	9.77e-08	197	515	17	314	ChainA, beta-galactosidase [Marinomonas sp. ef1]
5E9A_A	3.03e-07	267	540	120	388	Crystalstructure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_B Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_C Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_D Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_E Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_F Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3]
4UCF_A	5.16e-07	202	427	38	242	Crystalstructure of Bifidobacterium bifidum beta-galactosidase in complex with alpha-galactose [Bifidobacterium bifidum S17],4UCF_B Crystal structure of Bifidobacterium bifidum beta-galactosidase in complex with alpha-galactose [Bifidobacterium bifidum S17],4UCF_C Crystal structure of Bifidobacterium bifidum beta-galactosidase in complex with alpha-galactose [Bifidobacterium bifidum S17],4UZS_A Crystal structure of Bifidobacterium bifidum beta-galactosidase [Bifidobacterium bifidum S17],4UZS_B Crystal structure of Bifidobacterium bifidum beta-galactosidase [Bifidobacterium bifidum S17],4UZS_C Crystal structure of Bifidobacterium bifidum beta-galactosidase [Bifidobacterium bifidum S17]
1KWG_A	3.41e-06	201	452	17	246	Crystalstructure of Thermus thermophilus A4 beta-galactosidase [Thermus thermophilus],1KWK_A Crystal structure of Thermus thermophilus A4 beta-galactosidase in complex with galactose [Thermus thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GEA9	1.58e-06	196	452	10	246	Beta-galactosidase BgaA OS=Thermus sp. OX=275 GN=bgaA PE=1 SV=1
D4QFE7	2.83e-06	202	427	38	242	Beta-galactosidase BbgII OS=Bifidobacterium bifidum OX=1681 GN=bbgII PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000342	0.998947	0.000225	0.000153	0.000154	0.000160

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003237_01636.