CAZyme Information: MGYG000003237_01836

Basic Information

• Species: Victivallis sp002998355
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp002998355
• CAZyme ID: MGYG000003237_01836
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
700		78698.85	7.1786

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003237	4618450	MAG	United States	North America

• Gene Location: Start: 82950; End: 85052 Strand: -

Full Sequence      

MFFIGGPGNAFCRKVIVLDKPVSGAFAAVIADPHSYACPSWMEIPGMEHNWLLAGSLLKY
RLFVNGRTAGIGPARPVDPARTVETHFPLTGILHKGVNVVGVMSRGERFGFALSIRIDFT
DGSYREFVTGPDWKVLPANDIFSPVCWKKPALSFPKGSPGPGEQPEHINGERFPYGWLSP
DFDDSAWEQAVCFADDKAYSLEPAQIPQYQETRIAPVSIERLDDGRIVVDFGRAVFGSLE
LACRRAALVEVRLGEELLPYGGVRFQMRTGNCYQEGWSFPEGGARLFQFGLRSFRYAELV
GYPGKLIPRSIAALALNSPFDDGDSAFGCSDPRLGQVWQLCKNSVKYTTLDVYQDCPSRE
RMAYEADAYINMLTHFSVEARTRVARRTILYQMNHYTWPCEWRLFMAPVVYEYFMHTGDR
ALLKQVYGRLTAECSFHRLLRDGLVPEFPMRVIVDWPQSCRDNYEFGPDNAVPNAFVYWS
LDTLSKLAGYLGKKADCTEFAALAAKVKLAFNERLFDPEQALFVDNSKSRHAGFHTNMFA
VAFDLVGADRLERVADFIDRSGMKCSVYGAQFYLDALFKCRRADRAIELMTADSDRSWLN
MIRLGATVTTEAWNPELKPNMSFVHPWGSAPGNVIPRRLFGLQPTAPGWREFSFDPQPGP
LDFGTYRLKTPAGIVAAGFDRRSGELRSSCSLMRNEECPR

Enzyme Prediction     

No EC number prediction in MGYG000003237_01836.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	219	689	3.4e-98	0.9722222222222222
CBM67	48	192	1.1e-18	0.7784090909090909

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	6.77e-43	325	639	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	8.02e-09	60	198	16	158	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	9.01e-05	221	316	2	101	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.65e-04	641	698	1	59	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM45611.1	0.0	1	700	1	700
AVT37927.1	3.97e-126	60	684	399	1021
AVT31770.1	4.14e-125	60	684	399	1021
BCJ57454.1	2.14e-121	10	684	343	998
AVV47054.1	9.91e-109	60	684	347	979

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	6.53e-28	60	697	202	893	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KM26	1.91e-84	213	679	594	1112	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003237_01836.