CAZyme Information: MGYG000003237_01860

Basic Information

• Species: Victivallis sp002998355
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp002998355
• CAZyme ID: MGYG000003237_01860
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1143		125501.6	6.2151

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003237	4618450	MAG	United States	North America

• Gene Location: Start: 23836; End: 27267 Strand: -

Full Sequence      

MYCLKELSLFVAVCASCVLPAAPVPVDGGTLIIPKPGGSEKVACSAQNGEIRFPFNPAKP
GYAEVVLPRPLLLGSFRSACAAAKVRVPAGSPVRSMSLRLIDRNDEVFQYVSKADLSEGG
EFEVVWEVKPDEFQLSWGGDANRVFDMPGRILGFAFDFAGGAPASDLTLLGLDVDVEAPP
VLELPGDKAVYPLYRLNRDELFRHRGGSGTITLEGNGLLLDGIRNELVLGERRNEIVYLP
GRPVSLIFDAEHLGGEITAFAVLRDAKNTQFVSPEARLDRDGSPLVLDLGETLAEAVLPV
RMDTLFFRNAASGPGALRLKSASLRTVQPLVEALDFGIVTDTPVRVLRKGNEDALALQFT
NRSEKAGDFTVTLAYEHFDGTRFVEEVSASLAPGRTFTVKPRRRPDRLGHWQVTATVREA
GSPGQAAEKSRSFALLEPAGPTEGRAPGFLFSICTHTQWWSPGEQEKEVLAAALCGAKVI
RDSVEWYTLQPAADRWNFAPMDALVEAYGKVGIELQAMLAFTARWAAPEKLQNAQNWLEW
SRCKPDSAAWRNYAATVFARYRDKIRFWEVWNEPDLVGFNRMSLDEYVELQKIAFEEARK
VSPELKLLTGGYATLTPHQGLKSPDFQRDNLVKAKGFYDIHAYHEHGSFPAYVRLLDEKF
LPMRAGAGITVPWYANETAIHSLGGTERKQAYTLFKKLLFAWSRGAIGYTWYDLRNDGFD
PKNAEHNYGMLDNEFYPKPVYSVYNMLAGLFREAQFRRQLEIGNGSWAFEFAVPGGILIP
AWNESGATRTLPVTGAADSAFVIDAMGNRSALPVTDGMVLFEFGQAPVTLFLPGATRAEV
GQELLAVKADGFAVPGKPFPVRVRLRNPLNSKRTFSLKAESLPEGFTVDRAGKQVSVNAR
GETEAGFRLTARRGDRPQAGDRRLKLSYALSGTPWKGTVEIPIQVAVPVSAKKGAPDFVL
DSRSQVHSLTGADPALLHRAWSGPEDLSGKIRLENRDGAFVLKADVTDDRHIQPCPAEEA
WNGDSVQFAFALPGQAGFWEFCLSLSDSGEAVLTVPRAPRGYDSAQAAAAGTVKIVRKGT
TTGYEFRIPDRAVGLTPELYRQGFRFNLLINDNDGEGRDGWIQIAPGIGDEKNPGKFPFV
IFE

Enzyme Prediction     

No EC number prediction in MGYG000003237_01860.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	480	768	6.3e-25	0.7238979118329466

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	2.51e-64	956	1142	1	188	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd09619	CBM9_like_4	1.27e-09	981	1127	30	175	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
COG3693	XynA	3.77e-09	486	612	69	194	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].
cd00241	DOMON_like	1.79e-08	970	1122	1	156	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
pfam00331	Glyco_hydro_10	1.88e-08	486	608	46	166	Glycosyl hydrolase family 10.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46276.1	0.0	7	1143	1	1137
AVM47149.1	0.0	33	1143	197	1307
AVM44759.1	3.07e-194	185	1143	16	965
AHF94342.1	3.52e-162	315	1143	199	1033
AHF90198.1	1.04e-152	310	1142	170	1005

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JVK_A	4.27e-15	453	827	108	493	Structuralinsights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_B Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_C Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus]
4ZN2_A	1.54e-08	459	741	29	322	Glycosylhydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_B Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_C Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_D Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5BX9_A	1.54e-08	459	741	29	322	Structureof PslG from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5BXA_A Structure of PslG from Pseudomonas aeruginosa in complex with mannose [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000342	0.998965	0.000242	0.000148	0.000137	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003237_01860.