CAZyme Information: MGYG000003237_02071

Basic Information

• Species: Victivallis sp002998355
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp002998355
• CAZyme ID: MGYG000003237_02071
• CAZy Family: GH129
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
632		71207.59	5.7417

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003237	4618450	MAG	United States	North America

• Gene Location: Start: 11177; End: 13075 Strand: +

Full Sequence      

MGNQGKCLELDAEAFRFRAAGSVFRCRPEQLLRGKVYARPEKRTYEVRNFTFRELASTAS
RLVLEARNREFGFSATLDFTVSDDRLSVRIDPFKLIETRSASFRLLELSLLPGLLETERG
EEAEWLLPAYTGALAEPGRLTTDCRTRNRFYMDQSEWEKFNQFNAFCVMTRRGSLLAIVA
EGDFSAWCDSEVEDGFCRCFATFRLRHAPDELLSSGPMRIDYRMRAARVPWPELAMQYRS
CLIEETGVIPLSERLDGNPVLAYAAEAARIKLFLATKYPTVPDGSSPVRVHATFAEAGKI
LDALRGRGLEKAIVTLVGWNIDGHDGAYPTRFPVDPRLGGEEGLKALIAKATAMGYQIVV
HDNVTDAYLRSPDLDCDMLSTDEYGERQISGIWAGGEAYKLCPAVCLERYGATLDRIHAL
GFHGCAYLDAQTTGLFRCSHPKHPADEREFALSLCRILEYVRRLYGASSSENCASYALPY
CDEAANLGRSGWEQFRSRLDGGFNRLVSRIVPFYNVAVHGLVIYRSCWSSRTGLFGLYEN
LGNDWFEFEYTPGGLGCDFRDALDDVEASARIRRELPDLAGSFVEEYRENEDGIFIRFTH
DITFTFHTKGGTLTITRGSRVIAVINQNRDEK

Enzyme Prediction     

No EC number prediction in MGYG000003237_02071.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH129	229	526	3.6e-30	0.46601941747572817

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18952	DUF5696	2.36e-22	173	524	133	490	Family of unknown function (DUF5696). This is a family of unknown function with some overlap with clan family members of CL0058.
cd14244	GH_101_like	1.99e-15	307	471	42	208	Endo-a-N-acetylgalactosaminidase and related glcyosyl hydrolases. This family contains the enzymatically active domain of cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins (EC:3.2.1.97). It has been classified as glycosyl hydrolase family 101 in the Cazy resource. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae and other commensal human bacteria is largely determined by their ability to degrade host glycoproteins and to metabolize the resultant carbohydrates.
pfam12905	Glyco_hydro_101	9.06e-05	314	385	61	133	Endo-alpha-N-acetylgalactosaminidase. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae is largely determined by the ability to degrade host glycoproteins and to metabolize the resultant carbohydrates. This family is the enzymatic region, EC:3.2.1.97, of the cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins. This reaction is exemplified by the S. pneumoniae protein Endo-alpha-N-acetylgalactosaminidase, where Asp764 is the catalytic nucleophile-base and Glu796 the catalytic proton donor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM43182.1	0.0	1	632	1	632
BCT45910.1	1.03e-12	219	480	204	477
ALS27998.1	1.59e-12	171	524	285	644
QNI37238.1	2.68e-09	74	417	126	461
SMF83630.1	5.18e-08	296	401	169	282

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003237_02071.