CAZyme Information: MGYG000003237_02091

Basic Information

• Species: Victivallis sp002998355
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp002998355
• CAZyme ID: MGYG000003237_02091
• CAZy Family: GH2
• CAZyme Description: Beta-glucuronidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
569	MGYG000003237_59|CGC1	65003.51	4.7339

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003237	4618450	MAG	United States	North America

• Gene Location: Start: 40561; End: 42270 Strand: +

Full Sequence      

MRSYPSYPERHTLCLDGAWEFAWLGDEVDVNTVVPSMEVYDEIAAVPGCFDTAGERIGRR
GVGLYRRTFHFPAGQSRLTFGGVGLYARFWFDGREIGRSQIPYAVTEFEFPVEEGVHEVV
VAVDNRFDEENVPLFKPYADFYGFGGIYRSVVMQQLPKLAIDRLRVVTREFETGLIRVEL
TLRGLSPKVLKFSYGFDGEEMTPAEARVVDNQIAFEIEVPGFRLWSPEHPDLHLIAVRIK
DDFIVERFGIRTVEAKGRTILLNGEPLRLLGVNRHESHPEFGPVQPTQLMVDDLKYAREL
KANFIRGAHYQQNPEFLELCDQMGFLVWEESFGWGQPETDAENPETVELFCRASAIMAKS
SLNNPSVIIYGFLNESCSDTQAGKEMYRRIIQAIRAEDDSRLITYASNRFERDLCFDLAD
LISINPYPGWISDCDDWTRNNLEAVEPAIRRWAEHFSAGPAADKPLLISEIGACGIYGIR
SRERAQWSEEYQSDYFEAAVDAVLANPRYCGVTLWQMIDCKSFVNSGQIRCKPRGFNCAG
LLDEYRRPKLAFDTVKRLFRYYSEPDTNA

Enzyme Prediction     

No EC number prediction in MGYG000003237_02091.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	8	562	2e-82	0.6170212765957447

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10150	PRK10150	8.22e-53	10	568	10	604	beta-D-glucuronidase; Provisional
COG3250	LacZ	8.41e-50	1	525	1	566	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	2.43e-29	253	519	1	244	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10340	ebgA	1.65e-28	63	423	111	487	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	7.27e-27	15	376	55	463	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM47139.1	0.0	1	569	64	632
AVM46586.1	3.64e-165	1	559	1	558
QYY34828.1	3.58e-133	9	569	5	568
AHF91981.1	4.58e-125	11	559	23	589
QPC80831.1	6.44e-120	2	559	3	557

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6NCW_A	7.77e-89	1	560	2	553	Crystalstructure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCW_B Crystal structure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCW_C Crystal structure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCW_D Crystal structure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCX_A Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi],6NCX_B Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi],6NCX_C Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi],6NCX_D Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi]
7VQM_A	8.51e-47	65	564	98	586	ChainA, GH2 beta-galacturonate AqGalA [Aquimarina sp.],7VQM_B Chain B, GH2 beta-galacturonate AqGalA [Aquimarina sp.],7VQM_C Chain C, GH2 beta-galacturonate AqGalA [Aquimarina sp.],7VQM_D Chain D, GH2 beta-galacturonate AqGalA [Aquimarina sp.]
6D89_A	9.36e-46	10	564	34	592	Bacteroidesuniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis],6D89_B Bacteroides uniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis],6D89_C Bacteroides uniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis],6D89_D Bacteroides uniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis]
6D1N_A	1.96e-45	41	564	86	600	Apostructure of Bacteroides uniformis Beta-glucuronidase 1 [Bacteroides uniformis],6D1N_B Apo structure of Bacteroides uniformis Beta-glucuronidase 1 [Bacteroides uniformis],6D41_A Bacteriodes uniformis beta-glucuronidase 1 bound to D-glucaro-1,5-lactone [Bacteroides uniformis],6D41_B Bacteriodes uniformis beta-glucuronidase 1 bound to D-glucaro-1,5-lactone [Bacteroides uniformis],6D6W_A Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D6W_B Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D6W_C Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D6W_D Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D7F_A Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_B Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_C Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_D Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_E Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_F Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis]
6XXW_A	1.09e-38	4	566	23	594	Structureof beta-D-Glucuronidase for Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P12265	3.74e-38	140	564	206	628	Beta-glucuronidase OS=Mus musculus OX=10090 GN=Gusb PE=1 SV=2
O18835	1.47e-36	8	551	34	617	Beta-glucuronidase OS=Canis lupus familiaris OX=9615 GN=GUSB PE=1 SV=1
O77695	6.52e-36	138	551	202	615	Beta-glucuronidase (Fragment) OS=Chlorocebus aethiops OX=9534 GN=GUSB PE=2 SV=1
P05804	8.36e-36	8	551	8	580	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2
Q4FAT7	1.01e-34	140	551	207	618	Beta-glucuronidase OS=Sus scrofa OX=9823 GN=GUSB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003237_02091.