CAZyme Information: MGYG000003237_02142

Basic Information

• Species: Victivallis sp002998355
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp002998355
• CAZyme ID: MGYG000003237_02142
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1053		119067.13	8.2993

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003237	4618450	MAG	United States	North America

• Gene Location: Start: 99983; End: 103144 Strand: +

Full Sequence      

MKITKYPIFLFTLICFGCRLAAANLCEDASQWTLEGKSSDYSRLENAAAHGRNSLRLLYD
FKIREGRDLSLIIKPKEPIVLNRDSRLSLWIYDTASAHRFYFMCRDAGGKTALFCYTEND
FRSLRHNGWKEYGFSPAVDRCDIWGGNSKENPSLEFPVRLVAFWLDPVNRTRPQGELFLA
GLSVDGAEVATRNVPPPFRKPEAGTNRKPVLTISGSGSGTLSWAGERQLLRFHFQPGSRK
FGTCGEEIAFLDPDGNLLARLLRQVDCDTAFERSIPLPGEVKGFYRIRYRLLRDGGILFE
SKAAGGHFVPVPQPPPEQARLGMGFWNDNPERAYSTLRKMGIRWLRTDAGWSWIEPKQGE
FKWEGTDRSFRAAEQNGMSLLVTTQYIPKWAARQPYHQYGGNPEPAEWERFYRQLIERHG
RQIAVYEIWNEPDTPYHWSGGAQAYAAHMERTAKVIRRYAPQAKISHAGLTGEEKLWRPF
SEELMRYGVGSWFDIYSFHYGQGKSAPLHRRILEEAGLGSKPLWNTESGWGSADERILQT
VRDFAAGVEKSFYFEFQSKVPQFAETGMMTSAFQPNPVMPMFLTLSRLLDGNEPVRALPF
EPGEMYRIAPNRVIYRSEKGVTFRTDSKQLTHTDGFGRETVLTPVDGCVGVPSGGVSYLT
LPKKFELLPAMLEFAGEVSPVAGTSNRIALTVCNPGRRELHAVLKLTGSRQWEIPEARQE
LILRPKERRQLELELRPDLLSSETPFRCDAVLEAEGKTVAFQSCSGTVRSPVASSVRAFF
QGGRPGIRVDLRNLLKVPLATETVLRLPASWNSDSRRNVTLAPESTESFTVLFNDKVKVR
KNQFYFIDVAVSALGASSHTEYRLNWIGIPEIAPGSAREGLPLEAELKERGNYVPDHNIL
ETWLGPDDLSCRFSWGWSPEAIQMRWDVADDRHVSNSEPAFAWSGDSVQFWFDGRLYDLA
LIGGKSILYCHDGETGRKQMKLDIARNGARTVYDLEIFPEPGEVFRAGMNFSFSFCINDN
DGEPTRKGWMYHFAKTGIGGERKNSPQVTLMAK

Enzyme Prediction     

No EC number prediction in MGYG000003237_02142.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	358	507	8.7e-23	0.37819025522041766

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	5.34e-23	887	1050	5	188	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd09619	CBM9_like_4	2.15e-07	899	1045	26	185	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
cd00241	DOMON_like	5.07e-04	902	1027	11	154	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
COG3693	XynA	0.001	351	464	69	188	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].
smart00633	Glyco_10	0.004	351	390	3	46	Glycosyl hydrolase family 10.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM47094.1	0.0	1	1053	20	1072
AVM44950.1	9.59e-30	338	1030	337	1082
AVM45104.1	1.98e-23	331	1044	464	1125
AHF94342.1	4.88e-22	12	1048	41	1030
CAL80629.1	1.13e-21	351	555	46	267

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001094	0.670881	0.327271	0.000249	0.000247	0.000239

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003237_02142.