CAZyme Information: MGYG000003237_03224

Basic Information

• Species: Victivallis sp002998355
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp002998355
• CAZyme ID: MGYG000003237_03224
• CAZy Family: GH151
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
681		76447.97	7.1833

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003237	4618450	MAG	United States	North America

• Gene Location: Start: 24164; End: 26209 Strand: -

Full Sequence      

MKTLFDCYSRILIDNHITDLRPEYMAKFDPEHYAAMIRLAGIESAMVYASDHNGNCYYPS
KVGHVHAGCRGRDLFGETVKRLAGAGIVPVAYHTLVYQNEPAARHPEWRIRSITGEEPTG
RYRFCCPNHPAYREFCRQQIAEILAYDVAGIFLDMTFWPQICACSSCRAKYGAPLPETLD
WRNPAWVKFQRFREDSLAEFAHEMTTHARNCRPGIAVTHQFSPVLHGWFLGQSSGIASAS
DYASGDFYGGVLQQRFGCKLFQAYSRRIPYEFMTSRCVNLHDHTSTKSDEELFLHAATTL
ANGGAYFFIDAINPDGTLSRPFYERLGRIVARLEPFRKRVAELRPSLRAEVGLYFSMASC
VSEEKNGTPLARLHESNANNMGIRQNATLDEVLGTAEILNRLHIPYRVVTDETKELAGFR
AIIVNRAVFMTPEETGRLREFVRNGGTLIATGKTSLCRRNGESSGNFALADLFNVDYTGE
DAGVVSYLAAGEEQLFTRGLPAPLAKARERAEVKGVVSLPDFPPGDPEQYASIHSDPPGR
TTEFAGWVEHTYGSGKAVWLYSGLLALRQYSQQSFGEQLFTQLLPPFLIRSENFPPGAEL
TLLESEKKKQFLLGVVNHQPVLPVIPLRDVKLTIKLPAVPARVRRVSDGGEHPFEFRDGE
LTIALKRLEHIELFEIEVKHV

Enzyme Prediction     

No EC number prediction in MGYG000003237_03224.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH151	29	155	7.9e-34	0.9923664122137404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1874	GanA	1.68e-15	64	451	55	490	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam14871	GHL6	9.38e-15	29	155	1	135	Hypothetical glycosyl hydrolase 6. GHL6 is a family of hypothetical glycoside hydrolases.
pfam02449	Glyco_hydro_42	1.27e-08	104	308	79	335	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
cd03143	A4_beta-galactosidase_middle_domain	1.68e-06	389	479	25	114	A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to beta-galactosidase from Thermus thermophilus. Beta-Galactosidase hydrolyzes the beta-1,4-D-galactosidic linkage of lactose, as well as those of related chromogens, o-nitrophenyl-beta-D-galactopyranoside (ONP-Gal) and 5-bromo-4-chloro-3-indolyl-beta-D-galactoside (X-gal). This A4 beta-galactosidase middle domain lacks the catalytic triad of typical GATase1 domains. The reactive Cys residue found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow in typical GATase1 domains is not conserved in this group.
pfam08532	Glyco_hydro_42M	3.82e-04	399	451	39	90	Beta-galactosidase trimerisation domain. This is non catalytic domain B of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. This domain is related to glutamine amidotransferase enzymes, but the catalytic residues are replaced by non functional amino acids. This domain is involved in trimerisation.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44410.1	0.0	1	681	10	690
QNK60153.1	2.11e-105	8	677	10	691
BBD45930.1	6.44e-95	10	679	15	696
BBH23071.1	8.64e-93	8	677	7	676
QTH44200.1	3.03e-33	10	645	14	644

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003237_03224.