CAZyme Information: MGYG000003240_00018

Basic Information

• Species: Butyricimonas sp900761485
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Butyricimonas; Butyricimonas sp900761485
• CAZyme ID: MGYG000003240_00018
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378		42763.67	9.1879

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003240	3833164	MAG	United States	North America

• Gene Location: Start: 2579; End: 3715 Strand: -

Full Sequence      

MRYYVIVGEASGDLHASNLIKGLRKFDTDAEVRGWGGDLMRDAGCDIVRHYKDTAIMGFL
TVLKNLDKIKANIEACHQDILAWMPDVVILVDYGGFNLRVAKFIKEAKIPVFYYISPKIW
AWNTGRVKKIKRLVDRMFVIFPFEVNFYAQYDYPVQYAGNPLVDAIHDRPFKSETFDEFV
RANGLSGKPIIALVAGSRSQELKHVLPKMLTMVKHFPDHEFVIAGAPSMSDADYAPYLQN
VNVRIVYGQTYRLVRQARAALVTSGTATLETAILRTPQVVCYSGEGGALSYFLFKTFVKV
KYISLVNLIAGREVVTELLMQKLNERNLLRELSAIIPEGEKRNQMLAGYDEVNEKLGDVG
ASERFARMMINELARFHG

Enzyme Prediction     

No EC number prediction in MGYG000003240_00018.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	356	8.8e-115	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	4.73e-109	1	371	2	373	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	5.11e-101	1	375	2	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.24e-76	4	346	2	350	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.32e-61	5	370	10	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	9.27e-53	1	371	2	346	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO51639.1	2.71e-260	1	378	1	378
AZS31618.1	1.23e-256	1	376	1	376
ADY31424.1	3.37e-194	1	378	1	378
SNV26174.1	3.37e-194	1	378	1	378
AHF12800.1	2.77e-147	1	373	1	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	6.64e-40	5	375	11	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	9.25e-40	5	375	11	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3E4H8	4.08e-75	2	371	8	378	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q39T49	1.31e-73	2	375	8	382	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q74AT9	8.98e-71	2	375	8	382	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q1D393	4.21e-68	2	373	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	5.93e-68	5	370	8	375	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003240_00018.