CAZyme Information: MGYG000003242_01109

Basic Information

• Species: Prevotellamassilia sp000437675
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp000437675
• CAZyme ID: MGYG000003242_01109
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
847	MGYG000003242_95|CGC1	96140.82	6.4702

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003242	2630450	MAG	United States	North America

• Gene Location: Start: 27984; End: 30527 Strand: +

Full Sequence      

MKPTIDFILVYEPQNAHCAETIEIILNTDCVNQLFLIAGNSDAAQDAQAVTTQNAKRCSV
LQTDNVNGTKFLRLIAPKLEAKFTLFYLSSHDLKLGYRAIERLLQTAGYHADNFADNDPN
SALMLYSDRYDSNGLHPTIDYQTGSLRDDFDFGSLQLIRTSAIRHFLNNGRSPRYRFAGL
YALRLFISSKGEIVHLREPLYSEIETDLRVSGQKQFDYVNPRNKEVQQEMERACAEHLKQ
IGAWLAPDELNELPADTTVYPVEASVIIPVRNRARTICDAVNSALSQQADFTFNVIVIDN
HSTDGTTEALLQYAQNEQVKVLCPTRHDLGIGGCWDYAVRSEYCGRFAIQLDSDDLYAAP
DTLERIVAAFQQQHAAMVIGSYRMVDFDLNTLPPGLIAHTEWTAENGRNNALRINGLGAP
RAFRTDILRQIGFPNTSYGEDYALGLCFSRYFRIGRIYDELYLCRRWEGNSDAALSIESQ
NRNNAYKDALRTMEVQARQALVKRWNHPLNEEEISKFFDWQLTRWDEARERYEALASQVQ
TRVLPLEDGELRVQYNPSRIVSTGAKVDKKSLKARPCFLCENNRPDMQRALPVMGSIEVL
VNPFPILPHHLTIPTRRHTPQDFNRFASLLDKLAWQLPNYVVFYNGARCGASAPDHAHLQ
AGSKGLIPIERDWKIYENHLERIYPSNKDEEAELEELGYNPKNGGIFLLKDYACPAFVVQ
GPAAEKNPLLLNKLMSVMPIEDKRTEPDFNLLSWRHEGGPTAEDYLVTVVFPRRKHRPDC
YFASGRSKYLVSPGAIDMGGLIITPRAEDFERITPRIAQNILREVTLNDADIANIAKKLH
GGKRKTQ

Enzyme Prediction     

No EC number prediction in MGYG000003242_01109.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	265	397	8.3e-18	0.7647058823529411

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16269	DUF4922	7.90e-99	625	833	1	188	Domain of unknown function (DUF4922). This family consists of uncharacterized proteins around 310 residues in length and is mainly found in various Bacteroides and Parabacteroides species. Several members are annotated as putative glycosyltransferases, but the specific function of this family is still unknown.
cd00761	Glyco_tranf_GTA_type	1.35e-18	266	385	1	118	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	8.01e-18	265	428	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG0463	WcaA	8.60e-16	265	470	6	201	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd06433	GT_2_WfgS_like	4.79e-15	265	472	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ11638.1	0.0	44	844	19	814
QVJ80566.1	8.06e-267	51	839	44	804
ADE82754.1	1.14e-266	51	839	44	804
QUB41125.1	8.23e-266	29	847	32	807
QUB57862.1	1.51e-264	61	839	55	797

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003242_01109.