CAZyme Information: MGYG000003242_01415

Basic Information

• Species: Prevotellamassilia sp000437675
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp000437675
• CAZyme ID: MGYG000003242_01415
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1124		125263.55	6.414

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003242	2630450	MAG	United States	North America

• Gene Location: Start: 596; End: 3970 Strand: -

Full Sequence      

MNIKKYLSLAGLLFPMGMMAQTDSLLCDFETAESYAKVGVYDTWEHSPFRDKRLKGNAKV
TANPYTEVDDILGFAPNKSAKVLGAQRSRFGSNTFGAMVTLKKPFELKNKVRYVHVKIWT
PSDSRVMLIGLGRRTDRPWQPTTTEQFWQTSTAKVQPGKWCDAVFPVSGANGIEIHNLLV
VPDLKSTHDLKQDFLFYVDDIIIDDNSTPRFSSVYYGINFDEDQSIKNNDRLLNSVTFKP
ASQAEATVVPVNQGVTRKLYNKVLDQVLTAKPGEKVQVGFNWKGNAMSGYFYLDTNQNGR
FDVAVDGEQVKPGSEVLSYSHFKGKNSAGQSANAGLNMPEFTVPDTLKPGVYRVRYKVDW
DCVDPGGNTAADNTIYNNRGAFADMRLVVYTDNQQVTVKRGTRPNGGGLNGDVLKVDGSD
FAQEKIPFGKDYKVRLRPAPNFKFSHMIINHGNLASTDSLVFDTPQYMEHMAVARELDAD
SCYTIPAKYIDGDVELIPFFKSTDGQVQGKDYPINFSEDLAISRTDRRLNRVKFTATKGG
TSTLVVPHSGKELVFRNLTGEEVSAVPGDEIATEITYQGGPMHAYLYLDLDQDGHFDYTL
NADGTPSPSGELFAYSFFNNKNSQGASVQPSAGLAVPNFTLPKNLRYGNYRARLKVDWAN
IDPAGQWTEGGKENQIEANGGYVVDFILNVHPETSKLDIRTTNGSIVGKSNKGLPTEVPY
GRALNTLLVPAADGYKPGKLTVRHGHNLDGAQYIHGNRQWSEYTVDDAKVHIVKADSVNG
EVRMTVDFEPTAEADYKLVMADEFNTANGSMPDSKYWSRSEVGHGITWKRFVAQTEEGQQ
QTGYMEDGKLVMLCKPNTLAAEKDDKGQQQAMISGAIESKDKFDFTYGKIEARILTTPHT
GNFPAFWMMPTKTVKGWPKDGEIDIWEQIDDKDNSFHTIHSEWANKEAGCHGQANNPKKS
STISCESTQYHTFGLEWEEDKLSWYVDGRKVFSYAKSTDADALAKGQWPFDKHFYIILNQ
SVGNGSWAKPADTNFTYRTEFDWVRVYQKEGQVNTEIGQATDADANMDVYVRNGKIIVVA
PQETLVTVCDVQGRTIYREKVQGNVSIPLTKGVYVLNGRKVMVP

Enzyme Prediction     

No EC number prediction in MGYG000003242_01415.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	801	1047	4.2e-53	0.991304347826087

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	3.31e-56	802	1047	3	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd00413	Glyco_hydrolase_16	6.18e-23	802	1047	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd08024	GH16_CCF	2.77e-20	867	1023	90	275	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
cd02182	GH16_Strep_laminarinase_like	5.19e-20	796	1048	2	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
COG2273	BglS	6.74e-18	874	1067	105	286	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ12302.1	8.49e-141	1	813	5	804
QFQ13169.1	4.78e-111	507	1049	20	542
QUB63276.1	4.73e-71	791	1120	43	331
QKH89566.1	6.50e-71	791	1120	43	331
QUB81446.1	3.18e-70	789	1120	41	331

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2R_AAA	9.67e-27	796	1048	29	262	ChainAAA, Beta-glycosidase [Bacteroides caccae]
3ATG_A	3.69e-26	798	1047	5	238	endo-1,3-beta-glucanasefrom Cellulosimicrobium cellulans [Cellulosimicrobium cellulans]
4DFS_A	6.20e-24	782	1048	4	263	Structureof the catalytic domain of an endo-1,3-beta-glucanase (laminarinase) from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],4DFS_B Structure of the catalytic domain of an endo-1,3-beta-glucanase (laminarinase) from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1]
4CRQ_A	9.71e-24	795	1049	2	232	Crystalstructure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CRQ_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CTE_A Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans],4CTE_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans]
2VY0_A	1.07e-23	796	1047	13	259	TheX-ray structure of endo-beta-1,3-glucanase from Pyrococcus furiosus [Pyrococcus furiosus],2VY0_B The X-ray structure of endo-beta-1,3-glucanase from Pyrococcus furiosus [Pyrococcus furiosus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZG90	3.89e-33	792	1048	52	288	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1
P23903	1.44e-22	792	1050	419	682	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
O33680	3.12e-12	746	1032	187	441	Endo-1,3-1,4-beta-glycanase ExsH OS=Rhizobium meliloti (strain 1021) OX=266834 GN=exsH PE=1 SV=1
Q9Z3Q2	5.46e-12	801	1032	223	441	Endo-1,3-1,4-beta-glycanase EglC OS=Rhizobium meliloti (strain 1021) OX=266834 GN=eglC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000757	0.998294	0.000335	0.000205	0.000191	0.000184

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003242_01415.