CAZyme Information: MGYG000003242_01685

Basic Information

• Species: Prevotellamassilia sp000437675
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp000437675
• CAZyme ID: MGYG000003242_01685
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1204	MGYG000003242_142|CGC1	134884.03	5.8593

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003242	2630450	MAG	United States	North America

• Gene Location: Start: 1720; End: 5334 Strand: +

Full Sequence      

MKKISLNSIGLRAWFVLICLAVLPTWAADTNPRAIQDLLNRIGGEGTAKRFVTVVDESLA
QNGKEVFVITAQGGKPCIKGSTTLAVTTGINWYLNHTARVNLTWNNLTQDLSQTALPVPA
GEEKHVCNADYRYYLNYCTFSYSMSTWTWERWQQEIDWMALHGINMPLQIVGLDVVWYNL
LTKDLGYTAAEANQFVAGPCFQAWWGMNNLEGWGGPNPEWWYKRQAALAQNILKRQRELG
MQPVLPGYSGMVPSDIGKKGFTANNQGKWCTFTRPFILDPNSRDFATISDKYYKRLEELM
GTSVYYSMDPFHEGANTSGIDVPAAYSKIAEAMTKANPESKWVIQFWQWSGAQYHVLDRV
TKGRLVVLDLFSDAHTHFGDYKGHDAVYCMLANFGGRTGLFGRLTKIMEQYFAEKKQHGN
IKGIGATPEAIEQVPVLYDALFELAWRNEAPNAAEWLADYATARYGQPNADAQAAWEKVR
NSALNCETGLQGPHEAVLCGRPALEIGSVSSWGGTGIFYNPQDMADAAFLLLKAQNALKK
SPNYSYDLTDFTRQALTDYGYFLLKAVKAAYDSHDQAQYARCRDAYLQLVLDVDELLCTN
PNFMLGRWTQMARGIADEAKGTTAADREWLELNNARTLITTWGNRDASEWGGLRDYSYRE
WGGMMKDFYYQRWKTFFDNLDKGTQQPDWFDSDWKWVHNASLQYTEQPVGETAEVAKRLL
GKYFISLSAGEADTYHAYRYMTNDAQQVLRFKALRGQTFVLPVDALPESLNAQLAIDFNG
NGTFEAAETFNALKADIAADAATGFIPAQLSLNDGTKLTFTLIICDEIAEARTVSVNADP
KQGTVAIEGTDQLTLTTRDFVTLKAKAAAGYDFMNWTNAAKQIVSSKNPYTYMGAAAETF
TANFMPNKWGAPKEDRSELGTINDYGQFLTQLAASLNGQKEQTIYTIAKCPETLFETAEM
IQAPQGCELKLHWLARGGMGYCNLSAYIDLNADGDFDDKGEMVKAEGKKNTNENAQLNDY
TLSILLPYTVPQGVTRIRLRFDSAWKEGYNANGAMPANAATTRMVYDVPLNITAQAATPC
TVTVRSANTKQGTVDANGQPDTYTYKVGEEVVLRCYPAEGYELKCWKDKYNREVPSTWAD
GNFLRFFAPESNTYKAYFQKSTGIKEVKADKNKKKPTFSLNGQRAEHLERGQVYVQQGRK
FIAD

Enzyme Prediction     

No EC number prediction in MGYG000003242_01685.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	74	720	1.3e-198	0.9924585218702866

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	3.17e-156	132	448	1	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	1.95e-84	456	717	1	258	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
pfam12971	NAGLU_N	7.89e-15	33	119	1	79	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.
pfam18998	Flg_new_2	1.69e-04	833	907	2	73	Divergent InlB B-repeat domain. This family of domains are found in bacterial cell surface proteins. They are often found in tandem array. This domain is closely related to pfam09479.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ12583.1	1.01e-234	12	724	3	718
QCQ31494.1	2.12e-203	18	720	6	714
QCQ35767.1	2.12e-203	18	720	6	714
QCQ49150.1	8.37e-203	18	720	6	714
QTO27209.1	2.34e-202	16	720	10	714

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VC9_A	4.78e-123	26	726	165	880	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	5.79e-123	26	726	173	888	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	5.93e-122	26	726	188	903	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]
4XWH_A	1.18e-109	34	730	8	718	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54802	2.25e-108	34	730	31	741	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2
Q9FNA3	3.52e-92	21	724	37	805	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000359	0.998906	0.000196	0.000182	0.000176	0.000158

TMHMM  Annotations     

start	end
9	28