CAZyme Information: MGYG000003245_00454

Basic Information

• Species: Mediterraneibacter sp900761655
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Mediterraneibacter; Mediterraneibacter sp900761655
• CAZyme ID: MGYG000003245_00454
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
724	MGYG000003245_62|CGC1	83310.96	4.9279

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003245	2245318	MAG	United States	North America

• Gene Location: Start: 7054; End: 9228 Strand: +

Full Sequence      

MEERFAPVWLTIREFEHCVPRCMYHKENDGGLSDGCTAGDSGDSLKNLHVLARTELLIDK
KRGSGEKASREDRRILTISADDYYKLYVNGEYVAQGPAPAWPEKYYYNEIDLSPYLREGR
NVLALHLYYQGLINRVWNSGDGRFAFACGMEGTTFSWKYEICHAYSGTVTGYDTQYLEDF
DSRKWREDWKEPEFDDSGWTPVVRAGWADYRCVRQPTDMLQVYRKTPVRIEKTSYGWFID
MGQEITGALKVRAEAARDGAKAVIRCAEELEEKTEEHTEKQAEEPRVRYRMRCNCQYEET
WTLREGNCQTEPYDYKAFRYAEILCGDDVNVTEIEAEVRHYPMDEELCVLSSGNPMMDQI
FQICKNGVKYGTQEGYLDCPTREKGQYLGDAIVASRAQVWLTGDTRMLRKCIDQFASTST
VCPGIMAVAPGSYMQEIADFSLLWSQMLLTDYQFTGDQEFLSKYYPTAKGIVEYFRAYAR
KDGLLENVGEKWNLVDWPENLRDGYDFPLTRPVVGSGCHNVINALYIGAVKALGEIERIL
GLKTEHTEVWNRLKNWFMAAFYNEEKGLFRDSTVSGHCALHSNIYPLYFGICPRERTKQI
ADFLVEKGLSCGVLTGYFYLKALAAAGRYDDVYKVLVNESEHGWVNMIREGATTCWEAWG
KDQKWNTSLCHPWASGPIPVIIEDIAGYIPDPEQERGYRYEPHVPEELQVSFRMKIPFHS
CVES

Enzyme Prediction     

No EC number prediction in MGYG000003245_00454.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	236	709	1.6e-98	0.9047619047619048
CBM67	70	206	3.2e-27	0.8011363636363636

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.75e-38	350	673	6	328	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.07e-13	76	207	8	155	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam04685	DUF608	6.45e-07	451	554	111	200	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.
pfam06202	GDE_C	2.30e-04	438	572	83	221	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
pfam02837	Glyco_hydro_2_N	4.94e-04	66	125	77	131	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBE96895.1	4.89e-312	3	718	2	693
QQQ99835.1	1.12e-311	5	718	4	756
ANU45395.1	1.12e-311	5	718	4	756
QMW79864.1	2.15e-308	3	718	2	693
QIB57357.1	2.15e-308	3	718	2	693

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	3.34e-13	62	206	27	180	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KM26	4.11e-34	318	690	700	1077	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003245_00454.