CAZyme Information: MGYG000003247_00261

Basic Information

• Species: Borkfalkia sp900761675
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; Borkfalkia; Borkfalkia sp900761675
• CAZyme ID: MGYG000003247_00261
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
821	MGYG000003247_11|CGC1	93252.76	6.5023

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003247	1776245	MAG	United States	North America

• Gene Location: Start: 77788; End: 80253 Strand: -

Full Sequence      

MIAQLKVNGQMNNIAVDKSPEISWKYAFTKRPLVQESWRVTVQNMDSETVFDSGTIFGRQ
MSVVLPAEGLRSDERYSVCVCTRAGGKEHSASIQFETALLHPADWQAKWIKGSAVGTKFS
AREKPVRAKLFVSGLGYYHCYLNGEKLGDLYAAPAYTNYAKRIEYQIFDVTDCIGMENRL
YILLASHFEPGVKDCRYYQGEKMAVCQLHLHYADGSMECIASDEKFLSVAETPYVHTSIY
NGETLDMRLADTSFLNKDPEGEQWKKAETAENPVRLFAQNCPGVKIKRERRPVRVYWLGK
GRAVYDFGVNITGVLKVTAAGARGARLALRHAELLNGDHTLHCQTARIARAEDVYIFGGE
ERKQELQTYIPQFTYHGFRYAEVFYDGADPQSGEVKALEIATAMEETGKFRCGSPFLNRL
HKIMKQTLANNLYSVPTDCSQRDERQGWLGDAQIAMPAVLCLWDAKQFYRNYLEEIACGQ
NEDGSYTQLCAPPFVGGETLLWTGAFYMMADEMWEAYGDLNTIQTYYPALCRFYSSLARH
ETEKGMDIDNLHVGDWLGQYTSENHSCLAVYCDFAAKLSKFAKILGKSEEEQYYRGEFLR
LKDKYNHLYYFTTPDKSGAYGDTNEIGQYMNAVSVCFGLEADGEAEKVAETLAFDVEYSR
GTPTLTTGLVGTKYLFQALSKIGRNDLALRLFLKTDYPSWGFMLRKGATTVWERWEYLIG
NNMNSHCHSPLASPLSWLYRELCGISVEHGEDGMYIRLQPYYSKEVAFCEGETETCWGKV
RLRWEVKGKKRRTIFVIPPNAYAVFHGKKYGNGVFEVEESV

Enzyme Prediction     

No EC number prediction in MGYG000003247_00261.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	299	804	2.1e-125	0.9841269841269841
CBM67	117	272	4.7e-16	0.8465909090909091

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	9.55e-80	405	740	1	338	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	2.90e-32	124	288	2	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	9.01e-15	298	392	3	95	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.24e-04	755	806	11	62	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA22854.1	5.46e-119	3	806	30	850
VEH16339.1	3.70e-112	2	803	34	849
AIY87265.1	5.91e-112	13	806	17	838
AEE97752.1	1.36e-110	20	803	27	844
AEE96386.1	1.70e-110	20	803	29	838

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	2.16e-104	5	809	35	900	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	1.10e-76	123	803	314	990	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	3.32e-67	17	816	20	862	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	5.23e-76	123	803	314	990	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	1.56e-73	17	803	52	874	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
T2KPL4	2.04e-67	7	803	37	902	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
P9WF03	7.34e-61	17	805	48	876	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003247_00261.