CAZyme Information: MGYG000003248_00369

Basic Information

• Species: UMGS1004 sp900761685
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UMGS1004; UMGS1004 sp900761685
• CAZyme ID: MGYG000003248_00369
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
541	MGYG000003248_14|CGC1	59942.56	5.1842

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003248	2396863	MAG	United States	North America

• Gene Location: Start: 23898; End: 25523 Strand: +

Full Sequence      

MKASSDSVASVRKLIIPKCIVRVEGKVDNVGFLTEHKAEQIGLNESEFVFMHGRSGVILD
FGRELQGGLRIVTGYGTNGALVRIRLGESVGECLSDVGKKGSTNDHALRDVTLPLPMLSD
SEILSSGFRFANIELLDESAELRLKAINAVFVHSSRPQAGSFVCSDELINRIYDTAARTV
QLCAQKYIWDGIKRDRLVWVGDLYPEVTALLSVCDDDGCVADSLDFVKNETPLPRWMNNY
PMYSMWWIMIVEEYYRRTGNLAYVLAQKDYFCGLLHQIDGCIAENGDFDFGGNFVDWPTH
GHADEAEGVRCLAKLCAKSARVLESLYGMDGTLSEKILAKLSQKDVFVIEKKQIVALKYL
SGTPLSEAEKMLLTKDGACGFSTFMSYFLLSAQSDLADETYALSSLKEYYGGMLRLGATT
FWEDFDIDWEKGNVCPIDRIPQAGEIDVHGDYGRFCYEGYRHSLCHGWSAGVIPFLIGRI
LGVTPLEAGYRKVRVAPRLGGLSFIRADIPTPQGILHIECRAQDGKVHTDVKAPEGVEIV
G

Enzyme Prediction     

No EC number prediction in MGYG000003248_00369.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	55	538	8.6e-79	0.9761904761904762

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.29e-10	157	426	1	313	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	3.03e-08	482	538	1	58	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBM20341.1	2.88e-140	12	540	26	565
ATP57578.1	2.15e-139	3	540	31	583
QNL50446.1	3.52e-137	12	540	40	579
QTE39593.1	1.20e-136	3	540	32	585
QTF59433.1	1.69e-136	3	540	32	585

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	2.45e-36	56	536	193	688	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	1.94e-26	127	539	504	937	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	9.14e-09	57	469	95	531	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003248_00369.