CAZyme Information: MGYG000003249_00018

Basic Information

• Species: Victivallis sp900761715
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900761715
• CAZyme ID: MGYG000003249_00018
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355		39312.3	5.6228

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003249	2933905	MAG	United States	North America

• Gene Location: Start: 5994; End: 7061 Strand: -

Full Sequence      

MPITRFCISYDPALYQAWPDVAQAGDGRLVCVFNECTHHLNRDYTRIMQCVSFDRGRSWS
PKQPVTAGTAGAEYYYNCPRITTLSDGRLALLVDRIPAASGEQRTGDARNELRFSRDCGE
TWSAPVELPLRGIVPDQLCELDNGDWLIAAHHLSGDTWTQSLHYSTDKGERWSDEIIVAS
SSVLKFCEVSLLPLGNGAVVAFLRENSALGYDCKKVISHDNGRSWGTVCDFPLPGCHRPV
AGLLQDDKIMITYRFMQGGGSGKFGGGTQNFFAALTDRASALATTREQACVRILPIDFDR
AALSDLGYSGWVQFPDGELYIVNYIVDDAIDKGQIRGYALRLSEYLFASKHKQEG

Enzyme Prediction     

No EC number prediction in MGYG000003249_00018.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	19	228	2.3e-18	0.6461988304093568

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	6.55e-25	19	228	17	240	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	1.39e-18	27	234	1	209	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	9.10e-13	23	199	152	318	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	2.46e-04	19	128	165	257	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44758.1	1.34e-158	3	345	2	343
AYB46154.1	2.77e-119	1	349	1	344
ANY72719.1	2.86e-119	1	346	1	341
AHF91127.1	6.87e-114	3	345	2	355
AHF89372.1	5.17e-83	3	346	2	352

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W38_A	4.18e-07	13	225	15	219	Crystalstructure of the pseudaminidase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
3H6J_A	4.18e-07	13	225	15	219	Crystalstructure of a putative neuraminidase from Pseudomonas aeruginosa [Pseudomonas aeruginosa]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003249_00018.