CAZyme Information: MGYG000003249_00517

Basic Information

• Species: Victivallis sp900761715
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900761715
• CAZyme ID: MGYG000003249_00517
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
476		53727.28	10.2203

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003249	2933905	MAG	United States	North America

• Gene Location: Start: 27; End: 1457 Strand: +

Full Sequence      

MTWLPCRRPGGAGLVAPAAVIFLFSGLVFAIGTYGVLDAQLNFFLFLMMTMFYFAWSEPV
RWKQFGYLALAGVGCGLAFLTKGLLAVVLPAVAAVPFLLHQRQWKRIFTLPWIPLIAAAL
VALPVVAAVHRADPDFWRQFIWVEHFQRALSGAGANDDRSEPFWYFIPVILVGFLPWLLF
LPEAVRGVVRSGRFREWAKTPLISFSLMMLVVWFLFFSASSGKLGTYILPCFPALAILFA
DGLTRYRDLGDFTWANGTLRWFSRLLLPVPLLVFLWQVLGRFTKLVPPQLVLYDVNENYF
LPILALVLLVVWLRQAEREQDGNRKFLYFCFGIGFVMLAVHGSMPQRFTAALAPEEFIRQ
VAGPLAQPGTVLAADRALAASTAWALKRNDVHVYGRSGELEYGLSRLDGTPENRRISLEQ
LREQVRQGTPDIVIVTQSEKRVKEMPVTSNRRKYVGRGNKLFVVHYSSAVNSEVMQ

Enzyme Prediction     

No EC number prediction in MGYG000003249_00517.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	18	417	8e-73	0.7185185185185186

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13279	arnT	2.86e-76	18	447	116	533	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
COG1807	ArnT	2.21e-26	6	262	105	352	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam02366	PMT	3.00e-06	18	137	117	242	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam13231	PMT_2	0.002	18	126	55	158	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46371.1	1.54e-147	1	466	96	557
QSH42096.1	5.28e-82	3	456	99	543
AVF35041.1	2.57e-61	18	405	118	492
ACY84138.1	1.75e-60	3	442	100	527
ADM41323.1	1.75e-60	3	442	100	527

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	3.43e-16	66	245	190	366	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C5BDQ8	2.58e-60	3	435	100	520	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1
Q3KCC9	1.99e-56	1	459	115	558	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=arnT1 PE=3 SV=1
B4ETL9	1.49e-55	18	452	119	543	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT2 PE=3 SV=1
A4SQX1	3.58e-55	18	405	113	484	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnT PE=3 SV=1
A8FRR0	4.89e-55	21	466	119	541	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Shewanella sediminis (strain HAW-EB3) OX=425104 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000016	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
10	32
39	56
66	100
107	129
162	181
202	219
224	240
261	280
295	313
326	343