CAZyme Information: MGYG000003249_00897

Basic Information

• Species: Victivallis sp900761715
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900761715
• CAZyme ID: MGYG000003249_00897
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
936		104913.81	4.6805

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003249	2933905	MAG	United States	North America

• Gene Location: Start: 3652; End: 6462 Strand: -

Full Sequence      

MMDFSAKWIWSDDSDGRGRNLCSIFRREFRLEAAPETAALAVAADSFYRLKVNGVWLNDG
PARSYPNHTRYDLIGLDGLLRVGLNQIELIVRYFGCGNFHQIPQRAGVLAQLEFQRPDGT
LERLGTDSSWMAAKLPQWVEATPKNSIQRLPAELFDASVEAMPAWRNAVEVCGAQDGPWS
GLTPRDVRLLSRREFLLRRYVGASRVEPQPEVLAIDALQLNFPGETLVNTISFYPAVVGF
EVISPRVQSVSLRTPGFTIAVNGERDDEDGYYFHEGVNFIVAVTSDDSGHCTVNDIVFPA
ASGIAAPAPEACRVALFPELATAERGDSPWPWANPDWHTRREAFAALRPELLRLESMAAF
AGRFPEAMPGGTCGFVDDRAHAAFEYRVPTPVTPGEVIDPEALLYPDDRCTVLTPEAGHD
LELCYDLGEQNVGYWNFVLWAPAGTILDVSAVEYRTEDGVIQHTGVNYRNTMRYVCRAGW
NRYTSFERRSGRYLYLTIRNAAAPVRIQSFRLVESTYPVVADGAFDCSDFRLSRIWENAA
RTLKLCMEDTFTDCPLYEQTLWVGDARSESLFAMATYGAYDLVRRCIRLAGESLDELPLV
GSQVPSAWKNIIPVWSFMWNLSVKDYFDETGDAAFLAEVWPMVCKNLDSAATMIDPENGL
FRSLEWNLFDWSKTNSDQPILLHNSLFLVGALRATEALASAANDPAYGELCRERREKLVT
AINAAWDTRKLAWPDSISFDGTASEDVSIHTSFLALLFDAVDAEREAAVRANTLSPRSEL
IPVASPFASFYYYQTLEKLGQIPEIIEKMRLDYLPMLESGATTMWETYPGAFAGDPRFPT
RSHCHAWSAAPLYFLPKLVLGLIPAENGRKFLVSPWISSLDWAQGSRPTPFGRVEIRWRK
TAEKVLEIEVSGPPEVEFELKNNLSLKEWELALSRA

Enzyme Prediction     

No EC number prediction in MGYG000003249_00897.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	422	920	2.4e-94	0.9801587301587301
CBM67	6	179	2e-30	0.9943181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.68e-35	523	859	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	2.19e-05	33	187	1	155	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	4.26e-05	861	920	1	61	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam06202	GDE_C	0.002	619	853	89	373	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44894.1	0.0	2	923	1	918
AMV40823.1	2.62e-229	5	923	36	961
QHI68521.1	1.33e-209	2	925	1	905
AKJ65556.1	3.37e-208	6	935	8	943
AQQ70857.1	8.33e-203	6	927	3	931

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	1.49e-150	3	917	5	936	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
3CIH_A	2.87e-38	481	912	263	690	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
6GSZ_A	5.17e-09	426	898	331	816	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003249_00897.