CAZyme Information: MGYG000003249_01208

Basic Information

• Species: Victivallis sp900761715
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900761715
• CAZyme ID: MGYG000003249_01208
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1174		128721.64	6.3188

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003249	2933905	MAG	United States	North America

• Gene Location: Start: 6376; End: 9900 Strand: +

Full Sequence      

MSLFRWSLMSGGLCLALSASAVELNSDGVRCLLHRPAEKQQSMTASADPSGRPAMEIQWD
GAKAKYAEFALNPAPVLPQFKTLEVTAEVFLPENPGNRNFNIRLIDATGEVFQYSTSVAP
EEQGARAYTYRIDAATPAKGSWGGNRDGKFDWPVRLGGAAFDFRNANSGKLWVKSLTGKV
ISDGSSRHGIIDFAVTRPSIALHRPEEKAQRYRYEAMPDGKPALRIDWDNAKAAHVEFII
GQKLTLPEFTRARVRVNAYLPADCHARSLNLRLTDADGEVFQFGRPVPAGAQGWQEFCYE
IDAAKPAGGSWNGGAKANKKLDFPVVLTGFAADFKSRSGEGWLGIGEVKLDVVSGGVSLA
PQLETGNPIHVVVPGQEEKLGIRVVNPRDAEVRGELAYRVCDVDGRELAARQETVTVPAG
SDAFVSLPAPTGYGVYSVISTFRDLDGDSKPAERTMSYSYMLPAGPTPGPATGFLFGVCS
HPQGKSVAEQELEAMAAGWCGAKVVREDIGWGRMQPAADRWSFESFDRTVEIFGRYGIEL
EAIYSYVPDWAVAKDWQPVSTRYPGKKRPDYRHWAKFIRTFAERYRDKVRYVEVWNEPDL
IGFANFTAAEYLELMKIAYRETKAAAPEMIVLTGGFTCMPGMHGKMNDPEHMIKTIRDGK
GFYDVHAFHGHGPFSSYQPQIDDLVKLRESLGVTAPWYANETAISSIHIGERVQAVTLFQ
KFLYSWARGAMGYNWYDLRNDGFDPGENEHNFGLITKDFYPKAAYGVYNALATFYRDGAF
LHDLDLGAQLYGLLFRAKDGALLLAKWNGDNGGGSRLVILGGVTGKAAEIDLFGNTAERT
AHQGLLVTEVGTTPGSLRLEQSAEPRVVGELLRATGELVIAAGGRANLTYDLENPTDAPL
TFRFQVALPAGLTTPELTPAITVPAQGRAKLQLPIQAAPEFRSFYGQLKSLALTVDAGVL
WQGTIQSRIQTVTTLAAGEFRSVPDFTLASVSQLKMLAPNAPEKAHLFWKGAEDLSAKVW
LGRRQEFLQLKVEVRDDTHCQPFDGGGVWGGDNIQFALQLPGQSGYWELGLTRLSDGRSE
VFCWTAPRGYDAAATAAKIRLTTTRDEGTGTTGYLAELPLQAIGLTPEIGRRGFRFNLLV
NDNDGEMRESFLSIAPGIGESKNPARYPVINFQE

Enzyme Prediction     

No EC number prediction in MGYG000003249_01208.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	520	808	9e-26	0.7192575406032483

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	5.25e-75	984	1172	1	188	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd09619	CBM9_like_4	9.58e-13	1009	1145	30	162	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
cd00241	DOMON_like	7.17e-08	1007	1151	10	155	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
COG3693	XynA	1.30e-05	511	628	69	186	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].
pfam17786	Mannosidase_ig	5.27e-04	378	421	1	44	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF94342.1	1.99e-309	221	1174	80	1034
AHF90198.1	1.81e-288	200	1172	33	1005
AVM47149.1	1.42e-209	55	1173	52	1307
AVM46276.1	2.04e-189	14	1173	8	1137
AVM44759.1	4.70e-162	368	1172	167	964

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002377	0.996524	0.000417	0.000275	0.000190	0.000182

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003249_01208.