CAZyme Information: MGYG000003249_01664

Basic Information

• Species: Victivallis sp900761715
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900761715
• CAZyme ID: MGYG000003249_01664
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
788		87141.66	6.6717

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003249	2933905	MAG	United States	North America

• Gene Location: Start: 2366; End: 4732 Strand: -

Full Sequence      

MTIDNRGSEPLDLKGTVTVQETGYAKQETPLTVTVPAGQSGSITVPGDFTRQGSYQLAYQ
FQSASGKTYQGTHRVARMNPAGPTPGRAEEFLFGLCGHPERFSPEAAELEALAAGLCGAK
ILRVDFGWPRIQPRQGEWNFSTYDRLVEVFGRNGVELQCLLGYDAPWAVVQGYQPKNPEI
TGRPRLPDYRYFAEFAGKVAARYQDRIKYFEIWNEPDLIGFANFAPEQYMELLTHGYNAI
KHVAPDAKVMNGGIASARSNRSGNPNHNCGLLDLLKADGGKHFDLFAYHGHGSLSSYRDG
LEDLKKIGLLAPDTPWGWYSNETAETSAVIGEERQAASLFKKLLTAWSEGAMGYNWYLLR
EKEYYPMGHHERHFGLITADFEPKAGYVTYNMLANEYQGGKFLRQLPLGKGLSALLFSAR
NGQELLALWSDGQPRTLLLSGLPAGTVRIDLYGNETTVKQRDGLAYLKLSELPFTLKFPR
GAKPEIRTVGELLSSTLPQQLPLSPESPANLQVTLTNPSSTPLTVNLTLRLPDQVSCNRA
EQTRRLAPGGKETVTFALHATREFRANATDPALLWLELTPEGMQTETIPIKLIRRISAEE
PLFSLRQGSQYQSLVVSAPGNEAFYWQGPNDLSGQIHLTVKDQSLLFKAVVTDDKHVQPY
TGTAVWKGDGIQFALQLPGQNRFWKFGLTSLANGKPEVFCWSRPDGFHGTVPAIKLAVKR
EETAKETVYEATIPFSTIGMTPELAKTGFRFNVIVNDNDGELREGFLAAAPGLGQGDEPA
YWPIINLP

Enzyme Prediction     

No EC number prediction in MGYG000003249_01664.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	136	429	4.4e-25	0.7192575406032483

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	2.62e-66	601	787	1	188	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd09619	CBM9_like_4	7.09e-17	611	782	15	180	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
cd00241	DOMON_like	8.09e-09	626	766	12	155	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
COG2723	BglB	6.63e-06	118	249	72	219	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam01229	Glyco_hydro_39	3.32e-05	125	257	60	199	Glycosyl hydrolases family 39.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF94342.1	1.81e-165	50	785	288	1030
AHF90198.1	4.26e-145	76	786	301	1004
AVM46276.1	1.11e-130	51	785	401	1134
AVM47149.1	9.26e-128	48	785	570	1304
AVM44759.1	1.64e-122	34	785	214	962

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Z1H_A	3.63e-06	42	224	8	180	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003249_01664.