CAZyme Information: MGYG000003249_02404

Basic Information

• Species: Victivallis sp900761715
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900761715
• CAZyme ID: MGYG000003249_02404
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
622		69868.85	8.0389

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003249	2933905	MAG	United States	North America

• Gene Location: Start: 559; End: 2427 Strand: -

Full Sequence      

MKRAACLISLFAAAVLWGAAMDPYASEYGVCAHVGGHENAIAAREFARMNEAGIRYVRAD
FSWSGVEPKQGTWNFSHLDQVVAQAKKDHIALLPILNYDVAWATPAYRHLPLWTEYVRQV
VTRYQHDIPVWEVWNEPNLEGFWREKPDGANYATLLKATYETIKAVNPKLVVLYGGTAGI
PMEFIENSFKAGAGRYFDAMNIHPYRWNDLPEKPSLPEDIAKLRELMKRYRIAEKPIWIT
EMGWPTHRDQSARYQEIFGAMLAAGKIAPDATIGFISDPRYEQVPRFYPPSVLPGAKIVY
FTYDEIARCNPKNVPALVVTYGEGFPMKYLDALERYVKRGGMAIFPSGAPLYYDLILKKD
GSVESKHAPEAARERFHIGWDAWWINDKRAPKDAKQNEVAAPFRNLIQADGMHTQIFLTD
AKLKKGDQLVPIVSLRKGDYSNPIIAVYDLNSDLKGKVAICSYRNREVGSSPDQQARLLP
RAILLATGSGIAKYFWYEFQAPETDADDKESHFGIVHSNLEPKPAFTAYQTLILQRPDGS
TAPVLRQYPNEVWQAAWHRPDGTAGTALWTPAASVNCRLQLQGKLVEAVDYLGRPVKVDP
TAFEVTNGVVYLSGPGLTVTVK

Enzyme Prediction     

No EC number prediction in MGYG000003249_02404.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	69	251	2.9e-32	0.5034802784222738

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02449	Glyco_hydro_42	4.50e-07	39	167	9	169	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
pfam01229	Glyco_hydro_39	1.76e-06	51	179	45	198	Glycosyl hydrolases family 39.
COG2730	BglC	3.23e-04	46	187	79	239	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	0.004	46	177	30	168	Cellulase (glycosyl hydrolase family 5).
COG1874	GanA	0.006	28	79	18	70	Beta-galactosidase GanA [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44885.1	1.29e-169	13	615	12	611
QDU57372.1	2.83e-124	20	614	22	624
AVM44901.1	2.66e-72	26	588	25	600
CCW36010.1	4.97e-36	42	244	44	249
BBZ48197.1	2.81e-35	26	246	24	267

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZN2_A	1.07e-18	44	380	37	356	Glycosylhydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_B Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_C Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_D Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5BX9_A	1.07e-18	44	380	37	356	Structureof PslG from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5BXA_A Structure of PslG from Pseudomonas aeruginosa in complex with mannose [Pseudomonas aeruginosa PAO1]
5JVK_A	2.21e-16	27	244	105	343	Structuralinsights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_B Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_C Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus]
4EKJ_A	4.67e-09	116	246	140	283	ChainA, Beta-xylosidase [Caulobacter vibrioides]
4M29_A	4.67e-09	116	246	140	283	Structureof a GH39 Beta-xylosidase from Caulobacter crescentus [Caulobacter vibrioides CB15]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000557	0.998595	0.000261	0.000172	0.000179	0.000190

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003249_02404.