CAZyme Information: MGYG000003251_00319

Basic Information

• Species: Porphyromonas_A sp001808555
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas_A; Porphyromonas_A sp001808555
• CAZyme ID: MGYG000003251_00319
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376		42691.49	8.2673

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003251	1810024	MAG	United States	North America

• Gene Location: Start: 420; End: 1550 Strand: -

Full Sequence      

MKYFLIAGEASGDLHAAHLMSALRVEDPQADFAYMGGAAMRERGGACVLRSEEMAYMGIV
DVLRHYPEIRRGRNVVRQSLLDYRPDVVICVDYGSFCMRYILPFVRKQLPTTRIVYFIPP
KVWAWKEFRVRQLRRDCDLIQCIFPFEVPYFRSKGVERVSYIGNPTYEEVMHFRSHRSAD
VTIEERPYIALLCGSRLSEVRRNLPLMLESVASLGDRYRLVIAGVSAIDRSLYSEIIERY
SLQRVEVRYGETYEILSGADAALVTSGTATLETALLGVPQVVCYATRAGRLVNFAFDHFF
KVPYISLVNLIARREVVAELFGARCTVKAIRSHLTPLLSDTAERRAMLEAYDAVSEALRT
EFPASTLAAREIVALL

Enzyme Prediction     

No EC number prediction in MGYG000003251_00319.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	359	3.6e-99	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.24e-100	1	376	2	375	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	4.09e-100	1	376	2	379	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.11e-73	4	344	2	345	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	6.73e-59	5	375	10	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.56e-43	1	311	2	286	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEJ02201.1	6.81e-125	1	376	1	372
AVV53824.1	1.17e-105	1	375	1	372
ATS09476.1	5.86e-105	1	374	1	371
QUI91423.1	8.30e-105	1	374	1	371
ATS02318.1	8.30e-105	1	374	1	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	4.62e-34	5	359	11	366	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	4.62e-34	5	359	11	366	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B0KSB2	5.62e-58	5	376	8	372	Lipid-A-disaccharide synthase OS=Pseudomonas putida (strain GB-1) OX=76869 GN=lpxB PE=3 SV=1
Q88MG7	6.09e-57	5	376	8	372	Lipid-A-disaccharide synthase OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=lpxB PE=3 SV=1
A5W837	1.69e-56	5	376	8	372	Lipid-A-disaccharide synthase OS=Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1) OX=351746 GN=lpxB PE=3 SV=1
A6V1E5	3.60e-56	1	361	5	362	Lipid-A-disaccharide synthase OS=Pseudomonas aeruginosa (strain PA7) OX=381754 GN=lpxB PE=3 SV=1
Q1I639	1.30e-55	5	376	8	372	Lipid-A-disaccharide synthase OS=Pseudomonas entomophila (strain L48) OX=384676 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003251_00319.