CAZyme Information: MGYG000003251_01208

Basic Information

• Species: Porphyromonas_A sp001808555
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas_A; Porphyromonas_A sp001808555
• CAZyme ID: MGYG000003251_01208
• CAZy Family: GH63
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
536		62519.88	6.0921

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003251	1810024	MAG	United States	North America

• Gene Location: Start: 773; End: 2383 Strand: -

Full Sequence      

MLMRNRLPLLLLTLAASSLIASSQISSGNDSIYKLPYKNTYVKNVFVTDNVFRTMKPEIT
RPRSFDEAREILPLPQWEGHDEEIRMYWDAWKIAINNIRQPDAGSGFVATYIDTAYNGNL
FMWDDCFILMFARYGARFFPFQKTLDNFYAKQHPDGFICREIKANGADCFERYDPTSTGP
NLLPWCEMVYYHQYGDLERLHRVFPVLCGYYDWLRLNHTWRNGTYWSSGWGTGMDNMPRV
PEGYNPIYSHGHMIWLDTNLQQIMTAYRLLEMGFYIERWQEIEDYETEALALKDYVNTQL
WDEKSGFLYDQYRDGTLCDAKGIGAYWALMTDVLDKPRMDRLVAHLSEESEFARPHPIPS
LSADHPKYRPNGRYWQGGVWPGTNYMVIKGLSRQGYRDLAYKIAKRHYVSVLEVYRRTGT
FYEYYAPEEIEPGFMARDHFVGWGGLAPIALLIEYLIGIEADYPEETITWDIRQLEAHGI
DRYPFGPEGSIKLHCARRSTPGERPRVTVHSNVPFTLILTYGEGKSETLHIQPDRS

Enzyme Prediction     

No EC number prediction in MGYG000003251_01208.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3408	GDB1	1.93e-14	100	476	265	630	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
PRK10137	PRK10137	1.73e-13	269	404	591	736	alpha-glucosidase; Provisional
pfam03200	Glyco_hydro_63	2.10e-07	316	446	343	487	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
COG1626	TreA	5.76e-07	283	425	381	517	Neutral trehalase [Carbohydrate transport and metabolism].
pfam01204	Trehalase	3.97e-06	283	425	332	473	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPH58104.1	7.35e-282	9	523	6	520
QMI79244.1	2.10e-281	9	531	6	527
QQA30799.1	4.23e-281	9	531	6	527
QUU00424.1	4.23e-281	9	531	6	527
QUT64896.1	4.23e-281	9	531	6	527

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7T66_A	5.99e-15	197	446	533	806	ChainA, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T66_B Chain B, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T68_A Chain A, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T68_B Chain B, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T6W_A Chain A, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T6W_B Chain B, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T8V_A Chain A, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T8V_B Chain B, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495]
3W7S_A	2.48e-08	269	404	564	709	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7W_A	2.48e-08	269	404	564	709	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7X_A	2.48e-08	269	404	564	709	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
6XUX_A	2.64e-08	269	404	113	258	ChainA, Nanobody,Glucosidase YgjK,Glucosidase YgjK,Nanobody [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94250	8.63e-37	126	481	60	416	Uncharacterized protein BB_0381 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0381 PE=4 SV=2
O14255	2.90e-09	196	446	524	799	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
P42592	1.37e-07	269	404	587	732	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000401	0.998911	0.000226	0.000164	0.000147	0.000136

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003251_01208.