CAZyme Information: MGYG000003251_01252

Basic Information

• Species: Porphyromonas_A sp001808555
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas_A; Porphyromonas_A sp001808555
• CAZyme ID: MGYG000003251_01252
• CAZy Family: CE11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
465		51283.91	5.9983

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003251	1810024	MAG	United States	North America

• Gene Location: Start: 2003; End: 3400 Strand: +

Full Sequence      

MAYQHTLGGSFELKGKGLHTGRYIHLRALPAEENHGIRICRIDLPGKPILPALVRYATQS
DRCTTLRDGDFSVCTIEHMMAALSAMRVDNCLIELDGPEAPILDGSAKPYVDKINEVGLV
EQRAEARVYKVQRKIEVSDETSGAKLTILPDDTFAVDALISYDSPILTHQFASYEIGDDF
AGEIAPARTFVFVREVQALVANNLIKGGDLDNALVIYDRQLAQTDLNKLSDELGVDHSDA
SKLGYISHRPLAYPNEPARHKLLDVLGDLALAGCRIKGRVIATKPGHTINGRLCMKLFEE
IEREESLPPSIDLSAKPLLDTREIMRILPHRYPMLMVDKVLDLTDDQVIGLKNYSAGDPF
FVGHFPGEPIVPGVLLVESIAQIAGILVLHLMNESGPHSTYLARIENARFRQKVMPGDTV
IYRVKALAPVRHGFARVRGVGYVGDNTVCEAEVVARVVANNEDER

Enzyme Prediction     

No EC number prediction in MGYG000003251_01252.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE11	4	233	2.1e-70	0.8413284132841329

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13188	PRK13188	0.0	1	462	2	464	bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed
pfam03331	LpxC	9.96e-117	4	299	1	271	UDP-3-O-acyl N-acetylglycosamine deacetylase. The enzymes in this family catalyze the second step in the biosynthetic pathway for lipid A.
PRK13186	lpxC	6.67e-105	1	300	1	275	UDP-3-O-acyl-N-acetylglucosamine deacetylase.
COG0774	LpxC	5.12e-89	1	308	1	286	UDP-3-O-acyl-N-acetylglucosamine deacetylase [Cell wall/membrane/envelope biogenesis].
TIGR00325	lpxC	2.68e-59	4	307	3	281	UDP-3-0-acyl N-acetylglucosamine deacetylase. UDP-3-O-(R-3-hydroxymyristoyl)-GlcNAc deacetylase from E. coli , LpxC, was previously designated EnvA. This enzyme is involved in lipid-A precursor biosynthesis. It is essential for cell viability. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEJ03317.1	6.01e-176	1	457	5	461
AVV53596.1	1.25e-174	1	460	1	460
AOH39727.1	1.25e-174	1	460	1	460
QRO24856.1	8.27e-173	1	460	1	460
QCD35720.1	1.61e-172	4	460	3	459

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J3D_A	1.32e-46	1	300	1	277	Pseudomonasaeruginosa LpxC in complex with a hydroxamate inhibitor [Pseudomonas aeruginosa PAO1],4J3D_B Pseudomonas aeruginosa LpxC in complex with a hydroxamate inhibitor [Pseudomonas aeruginosa PAO1]
5U3B_A	1.39e-46	1	300	1	277	Pseudomonasaeruginosa LpxC in complex with NVS-LPXC-01 [Pseudomonas aeruginosa PAO1],5U3B_B Pseudomonas aeruginosa LpxC in complex with NVS-LPXC-01 [Pseudomonas aeruginosa PAO1],6MAE_A CHAIN A. UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase PA-LPXC Complexed with (R)-3-((S)-3-(4-(cyclopropylethynyl)phenyl)-2-oxooxazolidin-5-yl)-N-hydroxy-2-methyl-2-(methylsulfonyl)propenamide [Pseudomonas aeruginosa PAO1]
7K99_A	1.54e-46	1	300	1	277	CrystalStructure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor 19 [Pseudomonas aeruginosa PAO1],7K99_C Crystal Structure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor 19 [Pseudomonas aeruginosa PAO1],7K9A_A Crystal Structure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor [Pseudomonas aeruginosa PAO1],7K9A_C Crystal Structure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor [Pseudomonas aeruginosa PAO1]
5UPG_A	1.58e-46	1	300	2	278	Crystalstructure of LpxC from Pseudomonas aeruginosa in complex with PF-5081090 [Pseudomonas aeruginosa PAO1],6C9C_A Crystal structure of LpxC from Pseudomonas aeruginosa in complex with racemic ligand PT803 [Pseudomonas aeruginosa UCBPP-PA14],6CAX_A Crystal structure of LpxC from Pseudomonas aeruginosa in complex with PT805 [Pseudomonas aeruginosa],6DUI_A Crystal structure of LpxC from Pseudomonas aeruginosa in complex with PT801 [Pseudomonas aeruginosa LESB58],6E54_A Crystal structure of LpxC from Pseudomonas aeruginosa in complex with ligand PT802 [Pseudomonas aeruginosa PAO1]
5U39_A	2.44e-46	4	300	6	279	Pseudomonasaeruginosa LpxC in complex with CHIR-090 [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7MXT8	4.88e-173	1	462	1	462	Bifunctional enzyme LpxC/FabZ OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=lpxC/fabZ PE=3 SV=1
Q8A015	5.07e-170	1	460	1	460	Bifunctional enzyme LpxC/FabZ OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=lpxC/fabZ PE=3 SV=1
Q8KBX0	4.38e-109	1	458	2	463	Bifunctional enzyme LpxC/FabZ OS=Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) OX=194439 GN=lpxC/fabZ PE=3 SV=1
Q1D2K0	1.39e-54	4	308	8	287	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxC PE=3 SV=1
Q8YUR5	6.50e-52	4	298	3	276	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=lpxC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003251_01252.