CAZyme Information: MGYG000003252_00115

Basic Information

• Species: Bacteroides sp900761785
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900761785
• CAZyme ID: MGYG000003252_00115
• CAZy Family: GH128
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
313	MGYG000003252_6|CGC1	35516.17	4.7729

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003252	8296673	MAG	United States	North America

• Gene Location: Start: 30518; End: 31459 Strand: +

Full Sequence      

MKRINKIFTFMCILTLFSACTKDQMITDLTDEDGTATSSNKATIYKRGCGFSLGTSTGQW
WANIINLKANWYYTWGLTGCQDPYAPQNVEFVPMFWGHTNVTQSNIDMVNDLYRQKKIFY
VLGFNEPDLSSEGNMTVEQALEDWKKLSDGLDPGIKLVSPAVSWPGAAWFNDFMKGVQSQ
NLRMDYIALHIYMGQSPKTYSDQVKKIFSTYGKKIWITEFAPRDDSATSGKPETNKVSEE
WIRNNFIEPVLTDYENMDEVFRYAWFSGSPTMAGLWTSMLVDKDGKLTSLGDYYATIHPN
DDAAPANGMTMPQ

Enzyme Prediction     

No EC number prediction in MGYG000003252_00115.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	66	294	2.7e-54	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam11790	Glyco_hydro_cc	4.67e-45	54	294	4	235	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.
pfam01229	Glyco_hydro_39	2.50e-04	124	222	155	273	Glycosyl hydrolases family 39.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU97488.1	3.22e-235	11	313	1	303
ADY53175.1	1.10e-73	46	300	38	285
AMP98133.1	4.24e-71	46	300	40	287
QHS60881.1	3.20e-66	46	300	46	293
ACU64554.1	8.83e-64	46	300	49	296

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UAQ_A	1.63e-30	62	285	38	256	Crystalstructure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei],6UAR_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose [Amycolatopsis mediterranei]
6UFL_A	4.44e-30	62	285	38	256	Crystalstructure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) in the complex with laminarihexaose [Amycolatopsis mediterranei],6UFZ_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei]
6UAS_A	1.21e-29	62	285	38	256	Crystalstructure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199A mutant) from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaripentaose [Amycolatopsis mediterranei]
6UAT_A	1.21e-29	62	285	38	256	Crystalstructure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E102A mutant) from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaripentaose [Amycolatopsis mediterranei],6UAU_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E102A mutant) from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose and laminaribiose [Amycolatopsis mediterranei]
6UAV_A	1.16e-27	46	297	5	256	Crystalstructure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Pseudomonas viridiflava (PvGH128_II) [Pseudomonas viridiflava]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q09788	2.74e-14	46	294	296	528	Alkali-sensitive linkage protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=asl1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000063	1.000013	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003252_00115.