CAZyme Information: MGYG000003252_00417

Basic Information

• Species: Bacteroides sp900761785
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900761785
• CAZyme ID: MGYG000003252_00417
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
860		95258.84	6.9863

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003252	8296673	MAG	United States	North America

• Gene Location: Start: 90998; End: 93580 Strand: -

Full Sequence      

MKVFLSLLLTGMLLCCVAQVNAQQPLPYKNPLLPAEERVNDLLTRMTLEEKVAQIRHLHS
WDVFDGQELNQEKLHKMCEGISYGFFEGFPLTAASCRKTFREIQTYLVEKTRLGIPGFSV
AESLHGVVHEGATIYPQNIAMGSTFNPELAYEKTKYISGELNTMGVKQVLAPCIDVVRDL
RWGRVEESFGEDPYLCAQMAVAEVKGYLEHGISPMLKHYGPHGNPLGGLNLASVECGVRD
LFDIYLKPFEAVLTETEIMAVMSSYNAWNRVPNSASHFMLTDILRNKYGFRGYVYSDWGV
INMLKSFHKTAADDFEAATQVLTAGLDVEASSSCYAVLADKVRQGEFDIRYIDEAVRRVL
RAKIELGLFEDPYQERAAYRLPLRSEESVQLSRRIANESTVLLKNEGQLLPLNVEQLKSV
AVIGPNADNVQFGDYTWSKKKEDGVTPLQGIRRLVGDKVKVNYAKGCSLASLDTSEIAEA
VEAARHSDIALVFVGSSSTAFVRHSSEPSTSGEGIDLNDISLTGAQEQLIREVYAVGKPV
VVILVAGKPFAIPWVKKHIPAILAQWYAGEQEGNSIADILFGKVNPSGKLTFSFPQSTGH
LPAYYNYLPTDKGYYKEPGTYEKSGRDYVFSSSAPLWAFGHGLSYTQFEYLKAVADKEFY
QPHDTIRVTVQLKNAGKKAGKEVVQVYVRDVVSTVMTPVKQLKGFAKPELLPGQTREVTI
KIPVHELYLTDDLGNRYLEPGKFELQVGTASDHILFNLPVYAGTQKGGSRTASDTSIKSK
TSGKIIQVKGTVRDIQATPLPGVKVKSEDSKESVLTDYRGMYTLKVKDNARLVFSKKGFA
TKSIEVEGQADVSTQMAKGE

Enzyme Prediction     

No EC number prediction in MGYG000003252_00417.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	109	329	4.3e-63	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	3.17e-145	22	751	14	754	beta-glucosidase BglX.
COG1472	BglX	2.09e-87	46	460	1	392	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	1.14e-72	27	748	41	769	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	3.50e-70	400	645	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	1.49e-59	47	362	1	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASW16389.1	0.0	1	860	1	859
QQT79218.1	0.0	1	860	1	859
QUT25566.1	0.0	1	860	1	859
QRP58898.1	0.0	1	860	1	859
SCV06491.1	0.0	1	860	1	859

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	4.97e-161	28	761	7	755	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	3.89e-160	28	761	7	755	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	5.35e-130	28	754	36	777	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5XXL_A	1.64e-109	39	754	14	744	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	8.75e-109	39	754	14	744	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	2.61e-126	112	751	62	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	1.09e-116	28	751	29	744	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
Q56078	1.75e-111	17	754	9	757	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	3.58e-110	30	754	27	757	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
P14002	7.82e-83	112	755	34	661	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000182	0.999255	0.000162	0.000141	0.000124	0.000121

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003252_00417.