CAZyme Information: MGYG000003252_00936

Basic Information

• Species: Bacteroides sp900761785
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900761785
• CAZyme ID: MGYG000003252_00936
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
763	MGYG000003252_52|CGC11	84617.1	5.1101

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003252	8296673	MAG	United States	North America

• Gene Location: Start: 292384; End: 294675 Strand: -

Full Sequence      

MGISCIMGLSTASCQSGDKDYTNPDLPVSERVSALMSQMTLEEKVAQMCQYVGLEHMKKA
EKDMSAEDLKHSHSQGFYPGLHSSDVEEMTKKGMIGSFLHVVKAEEANYLQSLAQQSRLK
IPLLIGIDAIHGNGLYCGSTIYPTPIGQAATFDPALIERMSRETAVEMRASGMHWTFTPN
VEVARDARWGRVGETFGEDPYLVGQMGAATVRGFQTKDFTGDDKVIACAKHLVGGSQPAN
GINGAPAELSERTLQEVFFPPFKDCLEAGVFTVMTAHNELNGIPCHGSKYLMTEVLRNQW
KFDGFVVSDWMDIERMHDYHSVAETLKDAYRISVDAGMGMHMHGPEFYEAIIECVHEGSI
SEKQVDAAVSKILEAKFRLGLFENPFVDLKKKDETVFNAEHQKTALEGARKSIVLLKNEG
NMLPLEASKYKKVFVTGHNADNQSILGDWAMEQPEEHVTTVLEGLKAISPETAYNFLDLG
WNVRLLSDSQIKDAVQRARNSDLAILVVGENSMRYHWNEKTCGENSDRYELSLPGRQQEL
VEAVAATGVPTVVILVNGRPLTAEWIAENMPCIIEAWEPGVAGGQALAEILYGKVNPSGK
LPITIPRSTGQIQCMYNHKFTNHWFPYATGNSLPLYEFGYGLSYTTYKYDNLKLSEAAIT
PDKSVEVTIDVTNTGKMDGEETVQLYIRDEYSSATRPVKELKDFARIPLKAGETKQVSFT
LTPEMLSYYDADMHYGVEKGTFKIMVGASSRDTDLQSVILTVK

Enzyme Prediction     

No EC number prediction in MGYG000003252_00936.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	114	342	9.1e-75	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	5	757	5	761	beta-glucosidase BglX.
COG1472	BglX	1.83e-101	39	468	1	386	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	1.19e-91	12	747	33	769	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	1.07e-80	40	375	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	7.41e-69	413	644	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU93423.1	0.0	1	763	8	770
QNL39934.1	0.0	1	763	8	770
QUT88989.1	0.0	6	763	13	769
ALJ60237.1	0.0	12	763	15	768
ALJ59996.1	0.0	6	763	13	769

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z9S_A	1.68e-148	21	762	17	787	Functionaland Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum],5Z9S_B Functional and Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum]
5XXL_A	1.03e-146	32	763	14	752	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	5.71e-146	32	763	14	752	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	5.33e-144	83	751	44	741	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
6R5P_A	1.24e-138	13	760	19	764	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5P_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	3.20e-158	6	763	6	723	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	1.75e-135	13	752	18	746	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
P33363	4.76e-130	32	750	38	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	1.86e-129	32	750	38	754	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
A7LXU3	1.82e-118	13	747	16	762	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.582904	0.175250	0.240379	0.000445	0.000353	0.000675

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003252_00936.