CAZyme Information: MGYG000003252_01266

Basic Information

• Species: Bacteroides sp900761785
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900761785
• CAZyme ID: MGYG000003252_01266
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
982	MGYG000003252_84|CGC1	111277.39	8.4598

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003252	8296673	MAG	United States	North America

• Gene Location: Start: 28969; End: 31917 Strand: +

Full Sequence      

MKKLLLTLALCMGYLCTTVAQTFIKTEVKQSMRRVADWQIAHYNKAVYGDLNWVNATFYL
GLVHWAAIAEQTDKDDSYYKWLLRLGGRNYWQVDQRMYHADDICISQMYLYMYEKYKRKS
MLIPTQARAGWVIDNPPSGSFKLNYGDASTLEHWTWCDALFMAPPVYMKLYNITGNKKFI
RFMDKEYKATYDFLFDKEENLFYRDHRYFTMKEANGAKVFWGRGNGWVLGGLVEMLRELP
AKSKYRPFYQDLFQKLCRRIAPLQNKDGFWHASLLDPASYPSPETSCSGFFVYALAYGIN
EGLLPKDEFLPVVEKGWQALVSAVREDGKLGYVQPIGADPKKVTPDMTEVYGPGAFLLAG
TEVYRMAQDTPKQNTNISQSRIREIAAMLPDKPEGMGVSYKDRTFWNKVKESGNAEKLLT
EEAPALLKKGMPPFVDSLYLHLNKTNIRLPGENMMNARYHYLFRLTLAECLENKRRYIPA
IEKALVALCNQNSWSIPAHDRNLKNYHGTDYYVDLVVATAGNGIAQCVVMLDDRLSPEVK
ARVQCAFREKVFRPVYRCLEESKPFWWFTATNNWNSVCLAGVTGAALTLLADKEERAYFV
AAAEKYNVYGMKGYADDGYCSEGVGYYNYGFRAYILLREEVCRATQGRIDFFRDPKFVHI
ARYGKKIQMNEGVCPAYSDCRIGLSTDKFITDFCDRALGVTSPAEKYILPAGNNFSLYLI
ELFPRQVWKMEMTDAVRQALKEDSDSLRAYYEKAGILVVRPAAGSPCLLAVSAKGGNNAE
NHNHNDVGSYAVALGKSTMVGDQGGPFSYPGDYFSAEAPAKYKIKGSFGHPVPVVDGKTQ
SAGSKAKAIVLRKEFTEEKDLFSIDYTSAYSTPNLDKLIRTFVYDRQGEGSFTISDEFTA
NAPIRFETAVTTQADWKVLDDTRLLLTSGTEQMIVNIEASGKVAFTSETIEVNAPAYTRI
GIALKEQAAKGYIRLKMQAKQL

Enzyme Prediction     

No EC number prediction in MGYG000003252_01266.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	47	365	5.2e-85	0.9728915662650602
PL33	770	918	3.8e-45	0.9735099337748344

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	4.74e-115	32	366	2	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	5.52e-49	18	367	5	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU93291.1	0.0	1	982	1	982
QQT78475.1	0.0	1	982	1	982
QRP59640.1	0.0	1	982	1	982
ASM65007.1	0.0	1	982	1	982
QUU06731.1	0.0	1	982	1	982

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	3.33e-75	13	366	7	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	7.84e-51	152	365	154	373	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	7.40e-48	149	368	134	359	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
3K11_A	2.11e-17	139	366	187	413	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	6.54e-11	156	363	141	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	6.29e-76	2	366	3	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	1.14e-73	26	368	32	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	2.53e-68	24	363	53	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	3.58e-10	156	363	141	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
O31521	3.91e-09	156	333	133	299	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001007	0.998007	0.000297	0.000230	0.000216	0.000218

TMHMM  Annotations     

start	end
5	24